DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fdh and CG16935

DIOPT Version :9

Sequence 1:NP_524310.1 Gene:Fdh / 41311 FlyBaseID:FBgn0011768 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001286396.1 Gene:CG16935 / 36540 FlyBaseID:FBgn0033883 Length:357 Species:Drosophila melanogaster


Alignment Length:374 Identity:76/374 - (20%)
Similarity:129/374 - (34%) Gaps:103/374 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 EAKKPLVIEDIEVAPPKAHEVRIKITATGVCHTDAFTLSGADP-EGLFPVVLGHEGAGIVESVGE 81
            |.::.|.:.:.::..||.::|.:||.|..:...|..|:.|..| :..||.|.|:|....|..||:
  Fly    33 EPQEVLQLVEDKLPDPKDNQVLVKILAAPINPADINTIQGKYPVKPKFPAVGGNECVAEVICVGD 97

  Fly    82 GVTNFKAGDHVIALYIPQCNECKFCKSGKTNLCQKIRLTQGAGVMPEGTSRLSCKGQQLFHFMGT 146
            .|..|:||.|||.|                                               ..|.
  Fly    98 KVKGFEAGQHVIPL-----------------------------------------------ASGL 115

  Fly   147 STFAEYTVVADISLTKINEKAPLEKVCLLGCGISTGYGAALNTAKVEAGSTCAVWGL-GAVGLAV 210
            .|:..:.|..:..|..:::|..|.:........:|.|....:..::..|.|....|. .|||.||
  Fly   116 GTWTTHAVYKEDQLLIVSKKVGLAEAATSTVNPTTAYRMLKDFVQLCPGDTVIQNGANSAVGQAV 180

  Fly   211 GLGCKKAGAGKIYGIDINPDKFELAKK---FGFTDF-----VNPKDVADKGSIQNYLIDLTDGGF 267
            ...|:..|...:..:...|:..||.:.   .|.|:.     :...|:...|.::...:       
  Fly   181 HQLCRAWGINSVGIVRDRPEIAELKQMLQCLGATEVLTEAEIRTSDIFKSGKLKKPRL------- 238

  Fly   268 DYTFECIGNVNTMRSALEATHKGWGTSVVIGVAGAGQE---ISTRPFQLVVGRVWKGSAFGG--- 326
              .|.|:|.    :||.|.:.......|::...|..:|   ::|.|.      ::|..||.|   
  Fly   239 --AFNCVGG----KSATEVSRHLDNGGVLVTYGGMSREPVTVATGPL------IFKDIAFRGFWM 291

  Fly   327 --WRSVSDVPKLVEDYLKKDLLVDEFITHELPLSQINEAFDLMHKGESI 373
              |..        |:|...:           ......|.|:||.:|:.:
  Fly   292 TRWSK--------ENYSSPE-----------RSKMFKEIFELMEQGKFV 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FdhNP_524310.1 FrmA 9..379 CDD:223990 76/374 (20%)
alcohol_DH_class_III 9..378 CDD:176260 76/374 (20%)
CG16935NP_001286396.1 ETR 23..355 CDD:176250 76/374 (20%)
Qor 23..349 CDD:223677 76/374 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445838
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.