DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fdh and Drat

DIOPT Version :9

Sequence 1:NP_524310.1 Gene:Fdh / 41311 FlyBaseID:FBgn0011768 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_610293.3 Gene:Drat / 35687 FlyBaseID:FBgn0033188 Length:434 Species:Drosophila melanogaster


Alignment Length:199 Identity:39/199 - (19%)
Similarity:59/199 - (29%) Gaps:84/199 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IEVAPPKAHEVRIKITATGVCH-----TDAFT------------------LSGADPEGL-----F 64
            ||..|  |...||:|...|.|:     .::.|                  :|....:|:     |
  Fly    81 IEDTP--ALGARIRIVCAGACYRRRDRANSITSMSSVSSELSDYCPSVNSMSSPAHQGIREGSFF 143

  Fly    65 PVVLGHEGAGIVESVGEGVT-----NFKAGDHVIALYIPQCNECKFCKSGKTNLCQKIRLTQGAG 124
            |   |.|.||::||:|..:|     ..:.|..||.....:                         
  Fly   144 P---GFEVAGVIESLGSEITEANNRGLRIGQRVIVYPFDE------------------------- 180

  Fly   125 VMPEGTSRLSCKGQQLFHFMGTSTFAEYTVVADIS-LTKINEKAPLEKVCLLGCGISTGYGAALN 188
             .|.|                   :||..||.|:. :..|.:..|:|...:|..|....:.|...
  Fly   181 -TPAG-------------------YAELLVVPDLKHVVPIPDSLPMEVAAMLPTGALLAWNAVFK 225

  Fly   189 TAKV 192
            ...|
  Fly   226 AQAV 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FdhNP_524310.1 FrmA 9..379 CDD:223990 39/199 (20%)
alcohol_DH_class_III 9..378 CDD:176260 39/199 (20%)
DratNP_610293.3 Qor 142..430 CDD:223677 27/136 (20%)
MDR 144..428 CDD:302572 26/134 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445852
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.