DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fdh and CG17221

DIOPT Version :9

Sequence 1:NP_524310.1 Gene:Fdh / 41311 FlyBaseID:FBgn0011768 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001259984.1 Gene:CG17221 / 33521 FlyBaseID:FBgn0031500 Length:413 Species:Drosophila melanogaster


Alignment Length:377 Identity:79/377 - (20%)
Similarity:129/377 - (34%) Gaps:100/377 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 AHEVRIKITATGVCHTDAFTLSG----------ADP-EGL-FPVVLGHEGAGIVESVGEGVT--- 84
            ::|..::|.||.|...|...|.|          ..| :|: ||::||.|..|.:...|.||:   
  Fly    80 SNECLVRIRATAVNPIDLAMLRGYGATVLNKMRCQPGDGIEFPLILGREFCGELVQTGMGVSLPL 144

  Fly    85 ----------NFKAGDHVIALYIPQCNECKFCKSGKTNLCQKIRLTQGAGVMPEGTSRLSCKGQQ 139
                      ....|.|...:.:|     .:|.:...   :::...:.|.|:..|.:..|  |..
  Fly   145 GSRVWGVVPLQATIGSHAEYVAVP-----SYCLAPAP---KELDDYEAASVLYAGLTAWS--GLY 199

  Fly   140 LFHFMGTSTFAEYTVVADISLTKINEKAPLEKVCLLG--CGISTGYGAALNTAKVEAGSTCAVWG 202
            :...:|          .....|..:.....::|.:||  .|:.|.....|.:.||:..:||:.  
  Fly   200 ITGGLG----------GPCGATTASGGGAHKRVLVLGGSGGVGTLAIQILKSQKVQVLATCSE-- 252

  Fly   203 LGAVGLAVGLGCKKAGAGKIYGIDI-NPDKFELAKKFGFTDFVNPKDVADKGSIQNYLIDLTDGG 266
             .|:.:...||....       :|. ||...|...|:...|.|  .|.|.:|..:     ..:..
  Fly   253 -NAIEMVRNLGADLV-------VDYNNPQAMEELCKYAPYDIV--LDCAGQGGQK-----AAESK 302

  Fly   267 FDY----TFE--CIGNVNTMRSALEATHKGWGTSVVIGVAGAGQEISTRPFQLVVGRVWKGSAFG 325
            :|:    ||.  .:.|::         .:|.|...:..|...        ||..|..|.:.....
  Fly   303 YDFRQYITFSSPLLANID---------KQGLGVGALKNVFDL--------FQTNVRSVTQRGGLV 350

  Fly   326 GWRSVSDVP-------KLVEDYLKKDLLVDEFITHELPLSQINEAFDLMHKG 370
            .|...|..|       ||||......|:...:...|||     :||:.|..|
  Fly   351 KWGFFSPAPQGIQFLQKLVEQRKLMPLIDSSYGFSELP-----KAFEKMKSG 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FdhNP_524310.1 FrmA 9..379 CDD:223990 79/377 (21%)
alcohol_DH_class_III 9..378 CDD:176260 79/377 (21%)
CG17221NP_001259984.1 RTN4I1 52..406 CDD:176210 79/377 (21%)
Qor 52..406 CDD:223677 79/377 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445850
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.