DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fdh and SPBC1198.01

DIOPT Version :9

Sequence 1:NP_524310.1 Gene:Fdh / 41311 FlyBaseID:FBgn0011768 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_595070.1 Gene:SPBC1198.01 / 2540059 PomBaseID:SPBC1198.01 Length:423 Species:Schizosaccharomyces pombe


Alignment Length:401 Identity:101/401 - (25%)
Similarity:160/401 - (39%) Gaps:92/401 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TCKAAVAWEAKKPLVIEDIEVAPPK-AH--EVRIKITATGVCH-TDAFTLSGADPEGLFPVVLGH 70
            |.||.| |:.  ||.::..||..|. .|  :|.:|.||..:|. :|:...||..|......:|||
pombe    36 TMKACV-WDG--PLNVKIAEVPKPTITHPKDVIVKTTACTICSGSDSHIFSGEMPGIEKGAILGH 97

  Fly    71 EGAGIVESVGEGVTNFKAGDHVIALYIPQCNECKFCKSGKTNLCQKIRLTQGAGVMPE------- 128
            |..|||...|:.|.|.:.||.|:..:...|.:|.|||..:...|.   .|..:.:|..       
pombe    98 ESCGIVAEKGDEVNNLEIGDRVVIAFDLACGQCSFCKRHEYAACD---TTNDSKLMDVNYGSHHS 159

  Fly   129 ---GTSRL-----SCKGQQLFHFMGTSTFAEYTVV--ADISLTKINEKAPLEKVCLLGCGISTGY 183
               |.::|     .|:             |||..|  |:|:..|:.:..|..:...:...:.|..
pombe   160 AIFGYTKLLGDVPGCQ-------------AEYIRVPFAEINCCKLPDDIPDSEGLFMSDVLCTSL 211

  Fly   184 GAALNTAKVEAGSTCAVWGLGAVGLAVGLGCKKAGAGKIYGIDINPDKFELAK-KFGFTDFVNPK 247
            .|. ...:|:.|.|.|:||:|.:||..|...:..||.|:.||::.|::.|||: ||||| .::..
pombe   212 HAC-TLGEVKKGDTVAIWGMGPIGLYAGRWAQILGASKVIGIEVVPERIELARQKFGFT-VIDRN 274

  Fly   248 DVADKGSIQNYLIDLTDGGFDYTFECIG--------------------NVNTMRSALEATHKGWG 292
            :|:|   :...:::|...|.|...|..|                    :.:.:...|.|..|...
pombe   275 EVSD---VPKKIMELVSNGVDCAIEASGFRFSTSILHKVERAVGLETDSPDMITECLNAVRKYGH 336

  Fly   293 TSVVIGVAG------------------AGQEISTRPFQLVVGRVWKGSAFGGWRSVSDVPKLVED 339
            .|::....|                  :||......|..|:..:..|.....|        :|.:
pombe   337 VSIIADYVGTSNQFPIGHVVMKHLTIRSGQCPCQNYFGYVIDNIRSGKIDPRW--------MVTN 393

  Fly   340 YLKKDLLVDEF 350
            .:|.|.|.|.:
pombe   394 KIKFDDLPDAY 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FdhNP_524310.1 FrmA 9..379 CDD:223990 101/401 (25%)
alcohol_DH_class_III 9..378 CDD:176260 101/401 (25%)
SPBC1198.01NP_595070.1 FDH_like_1 37..421 CDD:176243 100/400 (25%)
Tdh 37..417 CDD:223991 100/400 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.