DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fdh and Adh7

DIOPT Version :9

Sequence 1:NP_524310.1 Gene:Fdh / 41311 FlyBaseID:FBgn0011768 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_599156.2 Gene:Adh7 / 171178 RGDID:621638 Length:374 Species:Rattus norvegicus


Alignment Length:376 Identity:198/376 - (52%)
Similarity:255/376 - (67%) Gaps:4/376 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TEGKVITCKAAVAWEAKKPLVIEDIEVAPPKAHEVRIKITATGVCHTDAFTLSGADPEGLFPVVL 68
            |.||||.|||||.|...:|..|||||||||||.|||:||.|||:|.||...:.|. ....|||::
  Rat     3 TAGKVIKCKAAVLWGTNQPFSIEDIEVAPPKAKEVRVKILATGICGTDDHVIKGT-MVSKFPVIV 66

  Fly    69 GHEGAGIVESVGEGVTNFKAGDHVIALYIPQCNECKFCKSGKTNLCQKIRLTQGAGVMPEGTSRL 133
            |||..||||||||.||..:.||.||.|::|||.||..|::.:.|||.:..|| |.||:.:||:|.
  Rat    67 GHEAVGIVESVGEEVTTVRPGDKVIPLFLPQCRECNPCRNPEGNLCIRSDLT-GRGVLADGTTRF 130

  Fly   134 SCKGQQLFHFMGTSTFAEYTVVADISLTKINEKAPLEKVCLLGCGISTGYGAALNTAKVEAGSTC 198
            :||.:.:.|||.||||.||||:.:.|:.||:.:||.||.||:|||.|||||||:.||||..||||
  Rat   131 TCKDKPVQHFMNTSTFTEYTVLDESSVAKIDAEAPPEKACLIGCGFSTGYGAAVKTAKVSPGSTC 195

  Fly   199 AVWGLGAVGLAVGLGCKKAGAGKIYGIDINPDKFELAKKFGFTDFVNPKDVADKGSIQNYLIDLT 263
            ||:|||.|||:|.:|||.|||.:|.|||||.|||:.|...|.|:.:||:|...  .|...|.|:|
  Rat   196 AVFGLGGVGLSVVMGCKAAGASRIIGIDINKDKFQKALDVGATECINPRDFTK--PISEVLSDMT 258

  Fly   264 DGGFDYTFECIGNVNTMRSALEATHKGWGTSVVIGVAGAGQEISTRPFQLVVGRVWKGSAFGGWR 328
            .....||||.||.:.||..||.:.|..:|||||:|...:.:.:|..|..|..||.|||..||||:
  Rat   259 GNTVQYTFEVIGRLETMVDALSSCHMNYGTSVVVGAPPSAKMLSYDPMLLFTGRTWKGCVFGGWK 323

  Fly   329 SVSDVPKLVEDYLKKDLLVDEFITHELPLSQINEAFDLMHKGESIRSIIKY 379
            |..||||||.::|:|...:.:.|||.||...|:|.|:|::.|:|||:::.:
  Rat   324 SRDDVPKLVTEFLEKKFDLGQLITHTLPFHNISEGFELLYSGQSIRTVLTF 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FdhNP_524310.1 FrmA 9..379 CDD:223990 194/369 (53%)
alcohol_DH_class_III 9..378 CDD:176260 194/368 (53%)
Adh7NP_599156.2 alcohol_DH_class_I_II_IV 3..374 CDD:176259 198/374 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I10921
eggNOG 1 0.900 - - E1_COG1062
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D324108at33208
OrthoFinder 1 1.000 - - FOG0000360
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100471
Panther 1 1.100 - - O PTHR43880
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.780

Return to query results.
Submit another query.