DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fdh and adh1a

DIOPT Version :9

Sequence 1:NP_524310.1 Gene:Fdh / 41311 FlyBaseID:FBgn0011768 Length:379 Species:Drosophila melanogaster
Sequence 2:XP_002934816.1 Gene:adh1a / 100487939 XenbaseID:XB-GENE-5929485 Length:375 Species:Xenopus tropicalis


Alignment Length:374 Identity:196/374 - (52%)
Similarity:263/374 - (70%) Gaps:3/374 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TEGKVITCKAAVAWEAKKPLVIEDIEVAPPKAHEVRIKITATGVCHTDAFTLSGADPEGLFPVVL 68
            |.||||.||||:||...|||.||:|||||||||||||||.|:|:|.:|...|........||.:|
 Frog     3 TTGKVIKCKAAIAWGLHKPLTIEEIEVAPPKAHEVRIKILASGICGSDLSVLKDKLSGVKFPTIL 67

  Fly    69 GHEGAGIVESVGEGVTNFKAGDHVIALYIPQCNECKFCKSGKTNLCQKIRLTQGAGVMPEGTSRL 133
            |||..|||||:|:.||..|.||..|.|::|||.:|:.||:...|:|:|...|...|:|.:.|||.
 Frog    68 GHEAIGIVESIGKDVTVVKPGDKAIPLFVPQCGQCRACKTPNCNVCEKNDFTTKKGLMQDNTSRF 132

  Fly   134 SCKGQQLFHFMGTSTFAEYTVVADISLTKINEKAPLEKVCLLGCGISTGYGAALNTAKVEAGSTC 198
            :|||:|::|||.||||.|||||.||.:.|::..||:|. ||:|||.:||||||:|||||..||||
 Frog   133 TCKGEQVYHFMSTSTFTEYTVVPDICVAKVDPAAPVEG-CLIGCGFATGYGAAVNTAKVTPGSTC 196

  Fly   199 AVWGLGAVGLAVGLGCKKAGAGKIYGIDINPDKFELAKKFGFTDFVNPKDVADKGSIQNYLIDLT 263
            ||:|||.||.:..:|||.||||:|.|:..:.|||..|.:.|.|:.::|||. || .||..:.|:|
 Frog   197 AVFGLGGVGFSALIGCKIAGAGRIIGVGSHKDKFPKAIELGATECLSPKDY-DK-PIQEVIRDMT 259

  Fly   264 DGGFDYTFECIGNVNTMRSALEATHKGWGTSVVIGVAGAGQEISTRPFQLVVGRVWKGSAFGGWR 328
            :||.|:.|||.|.:.||::|.::|:.|.|.:||:||||....:|..|.:|:.||..|||||||::
 Frog   260 NGGVDFAFECTGYIETMKTAFDSTYLGNGVTVVLGVAGPDDRLSFHPGELLFGRTMKGSAFGGFK 324

  Fly   329 SVSDVPKLVEDYLKKDLLVDEFITHELPLSQINEAFDLMHKGESIRSII 377
            |..:||.||.||::|...:|..::..:||.:|||||:||..|:.:|:||
 Frog   325 SRDEVPMLVSDYMEKKFNLDFMVSERIPLEKINEAFELMQSGKGVRNII 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FdhNP_524310.1 FrmA 9..379 CDD:223990 192/369 (52%)
alcohol_DH_class_III 9..378 CDD:176260 192/369 (52%)
adh1aXP_002934816.1 MDR 3..375 CDD:388358 196/374 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10681
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D324108at33208
OrthoFinder 1 1.000 - - FOG0000360
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43880
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.