DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp86D and Tsp42Ea

DIOPT Version :9

Sequence 1:NP_001262468.1 Gene:Tsp86D / 41310 FlyBaseID:FBgn0037848 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster


Alignment Length:261 Identity:67/261 - (25%)
Similarity:114/261 - (43%) Gaps:59/261 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SCVKYMIFLLNFLFWLFGGLLLAIGVYAF-----MDKLMDGNGWLRLDTIYDVIFNISLVMIIAG 88
            |.|||::|:.|.|..:.|.||:..|...|     ||...:.   ||..       .:.:.|||.|
  Fly     6 SMVKYILFIFNLLCSICGILLIVFGALLFSKVRNMDDFAEA---LRTQ-------QVPVTMIILG 60

  Fly    89 VIVFTVSFAGCLGALRENTWLLKLYSMCLLLFFILEMSLAIICFVFPQYMNSFLEYQFTDKIIHS 153
            .|:..:|:.||.||:||:..:...||  :|||.::...||::.:::.| .:.:||. ..|.:..:
  Fly    61 TIILLISWFGCCGAIRESYCMSMTYS--ILLFVLMIGQLALVIYMWVQ-KDKYLEI-MGDVVEKA 121

  Fly   154 YRDDSDLQNFIDFAQQEFNCCGLSNAGYQDWSKNEYFNCSSPSVERCGVPYSCCINATDISSGLV 218
            :...:...:::|..|....|||.|  ||.|::....|            |.|||.:..:      
  Fly   122 WNHRTSRSDYMDAIQISMKCCGRS--GYTDYAYQGKF------------PPSCCSDTNN------ 166

  Fly   219 NIMCGYGVQVRSVAAASKRIWTSGC-IEIVRVWVERNLYVIAGVALGIALLQ----LFVIYLAKT 278
               |.:           :.::..|| :..|..| :||..:|....|.||.::    :|...||.:
  Fly   167 ---CRW-----------ETVYRRGCKVTFVEFW-DRNSDIIKYAGLVIAAIEFVGFVFACCLANS 216

  Fly   279 L 279
            :
  Fly   217 I 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp86DNP_001262468.1 Tetraspannin 51..283 CDD:278750 57/239 (24%)
penumbra_like_LEL 132..255 CDD:239411 24/123 (20%)
Tsp42EaNP_525012.2 Tetraspannin 8..217 CDD:278750 66/257 (26%)
tetraspanin_LEL 104..188 CDD:239401 23/120 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442915
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.