DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp86D and tspan33b

DIOPT Version :9

Sequence 1:NP_001262468.1 Gene:Tsp86D / 41310 FlyBaseID:FBgn0037848 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_005159085.1 Gene:tspan33b / 567512 ZFINID:ZDB-GENE-060503-607 Length:266 Species:Danio rerio


Alignment Length:264 Identity:109/264 - (41%)
Similarity:168/264 - (63%) Gaps:18/264 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 FSYVSSCVKYMIFLLNFLFWLFGGLLLAIGVYAFMDKLMDGNGWLRLDTIYD-VIFNISLVMIIA 87
            ||:::..::|.:|..:||||:|..|::||||||...|        ..||:.| .:.:.::::|:.
Zfish    13 FSFLNPWIRYFLFFFSFLFWVFSLLIVAIGVYAKAQK--------ATDTVRDSFLIDPAVILIVV 69

  Fly    88 GVIVFTVSFAGCLGALRENTWLLKLYSMCLLLFFILEMSLAIICFVFPQYMNSFLEYQFTDKIIH 152
            ||::|.::|.||:||||||..|||::|..|.|.|:.:|::||:.|.:.:.....|. :|..|.|.
Zfish    70 GVVMFFITFCGCIGALRENIRLLKIFSFSLTLVFLTQMAIAILGFFYSEQTRDALG-EFVKKAIV 133

  Fly   153 SYRDDSDLQNFIDFAQQEFNCCGLSNAGYQDWSKNEYFNCSS--PSVERCGVPYSCCINATDI-S 214
            .||||.||||.:|:.|:||.|||.:|  |.|||.|.||||||  ||.|||.||:|||   |.: .
Zfish   134 HYRDDLDLQNLMDYIQKEFKCCGWTN--YTDWSWNPYFNCSSSNPSNERCSVPFSCC---TPLPR 193

  Fly   215 SGLVNIMCGYGVQVRSVAAASKRIWTSGCIEIVRVWVERNLYVIAGVALGIALLQLFVIYLAKTL 279
            ..::|.|||:|:|.::...|:|.|::.||.:...:|:|.:|.:...:.||:||.|:..|.|::.|
Zfish   194 ETVINSMCGFGIQTQNHLNATKSIYSVGCADRAVIWIESHLLLFGALTLGLALPQIAGIVLSQIL 258

  Fly   280 EGQI 283
            ..:|
Zfish   259 ISEI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp86DNP_001262468.1 Tetraspannin 51..283 CDD:278750 98/235 (42%)
penumbra_like_LEL 132..255 CDD:239411 56/125 (45%)
tspan33bXP_005159085.1 Tetraspannin 36..262 CDD:278750 99/239 (41%)
penumbra_like_LEL 114..234 CDD:239411 56/125 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1416189at2759
OrthoFinder 1 1.000 - - FOG0003557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X349
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.