DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp86D and tspan5b

DIOPT Version :9

Sequence 1:NP_001262468.1 Gene:Tsp86D / 41310 FlyBaseID:FBgn0037848 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001008591.1 Gene:tspan5b / 494048 ZFINID:ZDB-GENE-041212-12 Length:271 Species:Danio rerio


Alignment Length:267 Identity:104/267 - (38%)
Similarity:163/267 - (61%) Gaps:14/267 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 HFSY--VSSCVKYMIFLLNFLFWLFGGLLLAIGVYAFMDKLMDGNGWLRLDTIYDV-IFNISLVM 84
            ||:.  |..|:||.||..|.:|||.|...|::.::|:.:|.:..|    :.:|.|: .|:...:.
Zfish     5 HFNVHEVGCCIKYFIFGFNIIFWLLGVAFLSVALWAWSEKGVLSN----ISSITDLGGFDPVWLF 65

  Fly    85 IIAGVIVFTVSFAGCLGALRENTWLLKLYSMCLLLFFILEMSLAIICFVFPQYMNSFLEYQFTDK 149
            ::.|.::|.:.||||:||||||::|||.:|:.|.:.|.||::..::.|||..::...|:: |.:.
Zfish    66 LVVGGVMFVLGFAGCIGALRENSFLLKFFSVFLGIIFFLELTAGVLAFVFKDWIKDQLKF-FINN 129

  Fly   150 IIHSYRDDSDLQNFIDFAQQEFNCCGLSNAGYQDWSKNEYFNCSSPSV--ERCGVPYSCCINATD 212
            .|.:||||.||||.|||.|..:.|||.  .|.:||:.|.||||:..::  |:||||:|||  ..|
Zfish   130 NIRAYRDDIDLQNLIDFTQDYWECCGA--FGPEDWNLNIYFNCTDTNLSREKCGVPFSCC--TKD 190

  Fly   213 ISSGLVNIMCGYGVQVRSVAAASKRIWTSGCIEIVRVWVERNLYVIAGVALGIALLQLFVIYLAK 277
            .:..::|..|||.::.:........|.|.||:.....|::.||.|:||:.:||||||:|.|.||:
Zfish   191 PAEDVINTQCGYDIRGKGDIEHKTFIHTKGCVPQFEKWLQENLTVVAGIFIGIALLQIFGICLAQ 255

  Fly   278 TLEGQID 284
            .|...|:
Zfish   256 NLLSDIE 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp86DNP_001262468.1 Tetraspannin 51..283 CDD:278750 89/234 (38%)
penumbra_like_LEL 132..255 CDD:239411 47/124 (38%)
tspan5bNP_001008591.1 Tetraspannin 14..261 CDD:278750 100/255 (39%)
TM4SF9_like_LEL 113..233 CDD:239412 47/124 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48585
OrthoDB 1 1.010 - - D574036at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X349
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.