DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp86D and Tsp74F

DIOPT Version :9

Sequence 1:NP_001262468.1 Gene:Tsp86D / 41310 FlyBaseID:FBgn0037848 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster


Alignment Length:272 Identity:60/272 - (22%)
Similarity:119/272 - (43%) Gaps:49/272 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 FSYVSSC----VKYMIFLLNFLFWLFGGLLLAIGVY-----AFMDKLMDGNGWLRLDTIYDVIFN 79
            ||....|    |||.:|:.||:.::.|.::..:.::     :|:::|:..|  |....:|     
  Fly     3 FSSRMDCCGQFVKYSLFIANFVIFVGGAIVFCLTLWTLVDRSFVNELLGTN--LFSGAVY----- 60

  Fly    80 ISLVMIIAGVIVFTVSFAGCLGALRENTWLLKLYSMCLLLFFILEMSLAIICFVFPQYMNSFLEY 144
               |:::..:|:..|||.||:||.:|...||..|.:.:.|.|:..:...::.:||.:.:...:..
  Fly    61 ---VLLVTSIIICLVSFLGCVGAGKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRERVQQTMRQ 122

  Fly   145 QFTDKIIHSYRDDSDLQNFIDFAQQEFNCCGLSNAGYQDWSKNEYFNCSSPSVERCGVPYSCCIN 209
            :....:. .|....::....|..|:...|||:..  :.||  |.|    .|      ||.|||..
  Fly   123 EMRSTMA-LYGSRREITQAWDLTQERLQCCGVDT--WHDW--NRY----GP------VPESCCQE 172

  Fly   210 ATDISSGLVNIMCGYGVQVR--SVAAASKRIWTSGCIEIVRVWVERNLYVIAGVALGIALLQLFV 272
            .             :|.|.:  ::......::..||:.:...::..:..||.|.::.:|:|.:|.
  Fly   173 L-------------FGGQRKECTIFPTITNLYNQGCLYVTTNFIRDHAAVIGGTSIAVAILMIFG 224

  Fly   273 IYLAKTLEGQID 284
            :..:..|...|:
  Fly   225 MIFSCLLFNMIE 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp86DNP_001262468.1 Tetraspannin 51..283 CDD:278750 49/238 (21%)
penumbra_like_LEL 132..255 CDD:239411 22/124 (18%)
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 55/254 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.