DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp86D and rom1b

DIOPT Version :9

Sequence 1:NP_001262468.1 Gene:Tsp86D / 41310 FlyBaseID:FBgn0037848 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_957308.2 Gene:rom1b / 393989 ZFINID:ZDB-GENE-040426-1073 Length:352 Species:Danio rerio


Alignment Length:287 Identity:70/287 - (24%)
Similarity:119/287 - (41%) Gaps:54/287 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IFLLNFLFWLFGGLLLAIGVYAFMDKLMDGNGWLRLDTIYDVIFNISLVMIIAGVIVFTVSFAGC 99
            ::||:::....|.:..|.||  |:...:.....:.......::.|:.:.:.:|.|.:...:...|
Zfish    20 LWLLSWVAMFSGAVTFATGV--FLKTELHRRSEVMHSMDIHIVPNLLMAVGLASVGINICAGKVC 82

  Fly   100 LGAL------RENTWLLKLYSMCLLLFFILEMSLAIICFVFPQYMNSFLEYQFTDKI-----IHS 153
            ..:|      |..|.||..:  ||.:||   .||.::..:....:...||...  ||     |..
Zfish    83 QDSLDPSRFPRWKTLLLPFF--CLSVFF---TSLLLVAMILSYALQPSLEESL--KIGLKNGIRF 140

  Fly   154 YRD-DSDLQNF----IDFAQQEFNCCGLSNAGYQDWSK-----NEYFNCSSPSV-ERC------- 200
            |:| |:..:.|    ||..|.||.|||  |..|:||.:     |.|.:.:|..| :|.       
Zfish   141 YKDTDTPGRCFQKETIDRLQIEFQCCG--NTNYRDWFEVQWISNRYLDFTSKEVKDRVRSNVDGR 203

  Fly   201 ----GVPYSCCINATD---ISSGLVNIMCGYGVQVRSVAAASKRIWTSGCIEIVRVWVERNLYVI 258
                |||:|||..|:.   |...|::....|..:.:|   ....::..||.:.:..:....:..|
Zfish   204 YLLDGVPFSCCNPASPRPCIQYSLLDNNAHYNYEYQS---EELNLYNRGCRQALVSYYMGLMNTI 265

  Fly   259 AGVALGIALLQLFVI----YLAKTLEG 281
            ....|.:.|||:.::    ||...:||
Zfish   266 GPCVLLVFLLQMAILVGLRYLQTAMEG 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp86DNP_001262468.1 Tetraspannin 51..283 CDD:278750 67/271 (25%)
penumbra_like_LEL 132..255 CDD:239411 39/152 (26%)
rom1bNP_957308.2 peripherin_like_LEL 120..262 CDD:239415 39/148 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.