DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp86D and rom1a

DIOPT Version :9

Sequence 1:NP_001262468.1 Gene:Tsp86D / 41310 FlyBaseID:FBgn0037848 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_957088.1 Gene:rom1a / 393767 ZFINID:ZDB-GENE-040426-1765 Length:346 Species:Danio rerio


Alignment Length:288 Identity:62/288 - (21%)
Similarity:117/288 - (40%) Gaps:54/288 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IFLLNFLFWLFGGLLLAIGVYAFMDKLMDGNGWLRLDTIYDVIFNISLVMIIAGVIVFTVSFAG- 98
            :::|::|..:.|.:...:|  .|:...:...|.:..:|....:.|..:::.:|       |..| 
Zfish    20 LWMLSWLATVGGAITFTLG--CFLKTELRRRGEVMDNTDIHCVPNTLMIVGLA-------SMGGN 75

  Fly    99 ------CLGAL---RENTW--LLKLYSMCLLLFFILEMSLAIICFVFPQYMNSFLEYQFTDKIIH 152
                  |..||   |...|  .:|.:..|.:.|..|.:...|:.::....:.:.|:....:.|  
Zfish    76 YFASRICQDALDAGRFPRWKTYMKPFFGCSIFFTTLMLISIILSYIMKGSLETSLKIGLKNGI-- 138

  Fly   153 SYRDDSDL------QNFIDFAQQEFNCCGLSNAGYQDWSK-----NEYFNCSSPSV-ERC----- 200
            .:..|:|:      :..||..|.||:|||  |..|:||.:     |.|.:.||..| :|.     
Zfish   139 RFYKDTDIPGRCFQKQTIDRLQMEFHCCG--NTDYRDWFEVQWISNRYLDFSSKEVKDRIRSNVD 201

  Fly   201 ------GVPYSCCINATD---ISSGLVNIMCGYGVQVRSVAAASKRIWTSGCIEIVRVWVERNLY 256
                  |||:|||..::.   |...:.|....|..:..:   ....::..||.|.:..:....:.
Zfish   202 GRYLVDGVPFSCCNPSSPRPCIQYKITNDSAHYNYEHET---EELNLFIHGCREALVNYFMGLMN 263

  Fly   257 VIAGVALGIALLQLFVIYLAKTLEGQID 284
            .|..|.|.:.|:|..|:...:.|:..::
Zfish   264 TIGAVVLSVFLIQCSVLSSVRLLQTSME 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp86DNP_001262468.1 Tetraspannin 51..283 CDD:278750 59/269 (22%)
penumbra_like_LEL 132..255 CDD:239411 34/148 (23%)
rom1aNP_957088.1 Tetraspannin 20..288 CDD:278750 62/283 (22%)
peripherin_like_LEL 120..262 CDD:239415 34/148 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.