DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp86D and Tsp66E

DIOPT Version :9

Sequence 1:NP_001262468.1 Gene:Tsp86D / 41310 FlyBaseID:FBgn0037848 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_523985.1 Gene:Tsp66E / 39017 FlyBaseID:FBgn0035936 Length:267 Species:Drosophila melanogaster


Alignment Length:280 Identity:68/280 - (24%)
Similarity:125/280 - (44%) Gaps:67/280 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CVKYMIFLLNFLFWLFGGLLLAIGVYAFMD--------KLMDGNGWLRLD--TIYDVIFNISLVM 84
            |.||::.:.||:|::.|.::..:|::..:|        ||::..   |::  |....|..::.|:
  Fly     9 CAKYLLCIFNFIFFVLGTIIFGVGLWLAVDKHSLIALLKLVESE---RIEQFTQPQAIEQLAYVL 70

  Fly    85 IIAGVIVFTVSFAGCLGALRENTWLLKLYSMCLLLFFILEMSLAIICFVFPQYM----NSFLEYQ 145
            ::.|.::|.:||.|.|||:||:..||..|...|:|..|.|:....:...|...:    .:||:..
  Fly    71 LVIGAVMFFMSFLGYLGAMRESRCLLSTYGTFLILLLIAEIVAGGLGAFFKDKVRAESKNFLQTT 135

  Fly   146 FTDKIIHSYRDDSDLQNFI-DFAQQEFNCCGLSNAGYQDWSKNEYFNCSSPSVERCG---VPYSC 206
            .|.   :|..::.|..:.: :.....|.|||:::  |.|      |:.|...|...|   :|.:|
  Fly   136 ITS---YSLGENVDATSLMWNQLMGNFGCCGIND--YHD------FDASPAWVNGKGNRTIPDAC 189

  Fly   207 CINATDISSGLVNIMCGYGVQVRSVA-------------AASKRIWTSGCIEIVRVWV--ERNLY 256
            ||                   ::.||             :.|...:..||.|:...|:  :|.|.
  Fly   190 CI-------------------LKDVAKLVPRDEDCTTNPSDSNSFYKKGCYEVFTEWLIRQRELV 235

  Fly   257 VIAGVALGIALLQLFVIYLA 276
            ::| :|:||..|.|.::..|
  Fly   236 IVA-IAVGIVHLVLIILAFA 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp86DNP_001262468.1 Tetraspannin 51..283 CDD:278750 61/259 (24%)
penumbra_like_LEL 132..255 CDD:239411 28/145 (19%)
Tsp66ENP_523985.1 Tetraspannin 9..258 CDD:278750 68/280 (24%)
uroplakin_I_like_LEL 116..231 CDD:239409 27/144 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442922
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.