DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp86D and Tsp42El

DIOPT Version :9

Sequence 1:NP_001262468.1 Gene:Tsp86D / 41310 FlyBaseID:FBgn0037848 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_523638.1 Gene:Tsp42El / 35622 FlyBaseID:FBgn0033134 Length:217 Species:Drosophila melanogaster


Alignment Length:249 Identity:63/249 - (25%)
Similarity:107/249 - (42%) Gaps:54/249 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VKYMIFLLNFLFWLFGGLLLAIGVYAFMDKLMDGNGWLRLDTIYDVIFNISLVMIIAGVIVFTVS 95
            :||.:||.|.|:.:.|.|:|..|          |.||..:...|      ::.::|.|..:..:|
  Fly     8 IKYSLFLFNALWAILGILVLIFG----------GLGWGAMPDAY------AIGILILGGTILVIS 56

  Fly    96 FAGCLGALRENTWLLKLYSMCLLLFFILEMSLAIICFVFPQYMNSFLEYQFTDKIIHSYRDDSDL 160
            ..||.||:||:..:|..|:..||:..:|     |:.|:.....:.|.:|.. ..:.:.:..:...
  Fly    57 LFGCCGAVRESPRMLWTYASLLLILLLL-----IVAFIILNPKDVFKKYAL-QTVENQWELEQTK 115

  Fly   161 QNFIDFAQQEFNCCGLSNAGYQDWSKNEYFNCSSPSVERCGVPYSCCINATDISSGLVNIMCGY- 224
            ...:|..|:.:.|||..:|  ||:...:::|.:        ||.|||.:     ...||.:..| 
  Fly   116 PGSMDIIQKTYYCCGRDSA--QDYLDIKFWNNT--------VPSSCCKD-----DSCVNPLNLYV 165

  Fly   225 -GVQVRSVAAASKRIWTSGCIEIVRVWVERNLYVIAGVALGI-ALLQLFVIYLA 276
             |..::...|.:....|.|.:|    |         |: ||. |::.|..|.||
  Fly   166 RGCLIKVEEAFADEATTLGYLE----W---------GL-LGFNAVILLLAIILA 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp86DNP_001262468.1 Tetraspannin 51..283 CDD:278750 54/229 (24%)
penumbra_like_LEL 132..255 CDD:239411 26/124 (21%)
Tsp42ElNP_523638.1 Tetraspannin 7..196 CDD:278750 58/238 (24%)
tetraspanin_LEL 94..178 CDD:239401 21/99 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442919
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.