DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp86D and Tsp42Ek

DIOPT Version :9

Sequence 1:NP_001262468.1 Gene:Tsp86D / 41310 FlyBaseID:FBgn0037848 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001246161.1 Gene:Tsp42Ek / 35621 FlyBaseID:FBgn0033133 Length:215 Species:Drosophila melanogaster


Alignment Length:276 Identity:60/276 - (21%)
Similarity:101/276 - (36%) Gaps:78/276 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SSCVKYMIFLLNFLFWLFGGLLLAIGVYAFMDKLMDGNGWLRLDTIYDVIFNISLVMIIAGVIVF 92
            |.|||..:..||.|..|.|..|:||...|           |....|..::|...|     |.|:|
  Fly     5 SGCVKCFLNTLNTLNALSGLSLIAIATLA-----------LSKAPIAYILFLYGL-----GGIIF 53

  Fly    93 TVSFAGCLGALRENTWLLKLYSMCLLLFFILEMSLAIICFVF-PQYMNSF----LEYQFTDKIIH 152
            ..:..||.|...||..:...|...||...|:.: |.|..|.| .:|:..|    ::.::.::::.
  Fly    54 VSAVLGCCGICMENVCMTATYGFLLLAQLIISL-LGIFRFKFTEEYIEKFAAEEVQMKWDEELVE 117

  Fly   153 SYRDDSDLQNFIDFAQQEFNCCGLSNAGYQDWSKNEYFNCSSPSVERCGVPYSCCINATDISSGL 217
                    ...:|..|..:.|||..       |.::|.     ::.|..:|.||           
  Fly   118 --------PGAMDIYQTVYECCGRD-------SPDDYV-----AIGRQTLPPSC----------- 151

  Fly   218 VNIMCGYGVQVRSVAAASKRIWTSGCIEIVRVWVERNLYVIAG-------VALGIALLQLFVIYL 275
                  |..:...:..     :.:||::    ....|..|:..       :||||.:|.:...:.
  Fly   152 ------YPQEDPQMPH-----YLAGCVQ----KSSENFVVLFSYAHDTNWIALGITILMMIAAFY 201

  Fly   276 AKTLEGQIDLQKSRWS 291
               |.|:...|:.|::
  Fly   202 ---LVGRFRKQRVRYT 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp86DNP_001262468.1 Tetraspannin 51..283 CDD:278750 48/243 (20%)
penumbra_like_LEL 132..255 CDD:239411 18/127 (14%)
Tsp42EkNP_001246161.1 Tetraspannin 7..202 CDD:278750 55/260 (21%)
tetraspanin_LEL 94..174 CDD:239401 17/125 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.