DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp86D and Tsp42Ej

DIOPT Version :9

Sequence 1:NP_001262468.1 Gene:Tsp86D / 41310 FlyBaseID:FBgn0037848 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_523636.1 Gene:Tsp42Ej / 35620 FlyBaseID:FBgn0033132 Length:227 Species:Drosophila melanogaster


Alignment Length:264 Identity:56/264 - (21%)
Similarity:84/264 - (31%) Gaps:77/264 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PHHFSYVSSCVKYMIFLLNFLFWLFGGLL--LAIGVYAFMDKLMDGNGWLRLDTIYDVIFNISLV 83
            |..:..:.:|:  :|...|..|:..|...  .|:.||.                        |..
  Fly     9 PWKYGLLVTCI--LIVTCNVFFFSCGVTTWGSAVSVYG------------------------SYG 47

  Fly    84 MIIAGVIVFTVSFAGCLGALRENTWLLKLYSMCLLLFFILEMSLAIICFVF----PQYMNSFLEY 144
            ..:.|..||.|:|.|...||:.:......|.:|..|..   .:|....|.|    .|.|..| |.
  Fly    48 SALCGGAVFGVAFLGMYVALKVSYKYSIYYLICSGLVI---AALGSYLFTFTAMREQLMGRF-EE 108

  Fly   145 QFTDKIIHSYRDDSDLQNFIDFAQQEFNCCGLSNAGYQDWSKNEYFNCSSPSVERCGVPYSCCIN 209
            :..|........|..:|.    ....|.|||:.  |.||:.:.|:          ..:|.|||. 
  Fly   109 RMRDLFERKTHSDDKMQP----VHSLFGCCGIE--GPQDYLQEEH----------GALPSSCCY- 156

  Fly   210 ATDISSGLVNIMCGYGVQVRSVAAASKRIWTSGC----IEIVRVWVERNLYVIAGVALGIALLQL 270
            |.|.|.                   ...::..||    :..:|:..|.|.|....: :.:..|.|
  Fly   157 AFDCSK-------------------PAHVYEEGCSTKAVATLRMQAELNYYSCMAI-IALEFLGL 201

  Fly   271 FVIY 274
            |..|
  Fly   202 FTAY 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp86DNP_001262468.1 Tetraspannin 51..283 CDD:278750 50/232 (22%)
penumbra_like_LEL 132..255 CDD:239411 28/130 (22%)
Tsp42EjNP_523636.1 Tetraspannin 11..211 CDD:278750 55/262 (21%)
tetraspanin_LEL 97..183 CDD:239401 25/122 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.