DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp86D and Tsp42Ec

DIOPT Version :9

Sequence 1:NP_001262468.1 Gene:Tsp86D / 41310 FlyBaseID:FBgn0037848 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_523629.1 Gene:Tsp42Ec / 35612 FlyBaseID:FBgn0033124 Length:232 Species:Drosophila melanogaster


Alignment Length:270 Identity:61/270 - (22%)
Similarity:106/270 - (39%) Gaps:73/270 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VSSCVKYMIFLLNFLFWLFGGLLLAIGVYAFMDKLMDGNGWLRLDTIYDVIFN------ISLVMI 85
            :|..|.::::::|.:|.:.|.||:.:|.....|.           :.:||..:      |.:.:.
  Fly     4 LSGIVNFILYIVNIVFLIVGILLIVLGSIMLSDL-----------SRFDVAGSGTDPNTIPICVT 57

  Fly    86 IAGVIVFTVSFAGCLGALRENTWLLKLYSMCLLLFFILEMSLAIICFVFPQYMNSFLEYQFTDKI 150
            :.|.::|.|||.||.|..|::..:...|:..:.:.|||:  |.:.|:||.. .::||        
  Fly    58 VLGGLIFVVSFFGCYGIFRQSVCMTGAYTSMVFVLFILQ--LVLTCWVFVN-RSAFL-------- 111

  Fly   151 IHSYRDDSDLQNFI----DFA-----QQEFNCCGLSNAGYQDWSKNEYFNCSSPSVERCGVPYSC 206
                .|.|:|.|.:    |:.     ::.|.|||       |.|...|.|..      ..||.:|
  Fly   112 ----GDMSNLVNLLWDSHDYTAMGVLEETFGCCG-------DTSYTNYNNIG------LSVPGTC 159

  Fly   207 CINATDISSGLVNIMCGYGVQVRSVAAASKRIWTS--GCIEIVRVWVERNLYVIAGVALGIALLQ 269
            |                 |...|.....:..::.|  ||......:...|:.:|....||:.:..
  Fly   160 C-----------------GYLDRQATCNTPSVYQSRPGCSAKFEEFWNDNMDIIRWSGLGLCIFD 207

  Fly   270 LFVIYLAKTL 279
            |.|..:|..|
  Fly   208 LVVFLIAGAL 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp86DNP_001262468.1 Tetraspannin 51..283 CDD:278750 54/246 (22%)
penumbra_like_LEL 132..255 CDD:239411 26/133 (20%)
Tsp42EcNP_523629.1 Tetraspannin 7..221 CDD:278750 60/267 (22%)
tetraspanin_LEL 104..193 CDD:239401 25/131 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442913
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.