DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp86D and Tsp33B

DIOPT Version :9

Sequence 1:NP_001262468.1 Gene:Tsp86D / 41310 FlyBaseID:FBgn0037848 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_523552.1 Gene:Tsp33B / 34590 FlyBaseID:FBgn0032376 Length:326 Species:Drosophila melanogaster


Alignment Length:271 Identity:65/271 - (23%)
Similarity:106/271 - (39%) Gaps:74/271 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 GLLLAIGVYAFMDKLMDGNGWL-----RLDTIYDVIFNISLVMIIAGVIVF----TVSFAGCLGA 102
            |||:.: |.|:...::  .|:|     ||  :|..:|         |:.||    .|:|. |..|
  Fly    23 GLLILV-VTAYYHTVL--TGYLSDIECRL--VYGYLF---------GIYVFGAQVVVTFL-CSIA 72

  Fly   103 LRENTWLLKLY-SMCLLLFFILEMSLAIICFVFPQYMNSFLEYQFTDKIIHSYRDDSDLQNFIDF 166
            :....|..:.. ::.|||......|..||...|....|.   |:..|.:.::  .|:.|...||.
  Fly    73 MWRRIWRRRCTPNIRLLLSVWAFYSCVIIASGFGCVWNL---YRGVDVLENA--ADTSLTRGIDM 132

  Fly   167 -------------AQQEFNCCGLSNAGYQDWSKNEYF-----NCSSPSVERCGVPYSCCINATDI 213
                         .|....|||:.  ||:||...|:.     ||:|..:    .|::||..:.| 
  Fly   133 YYSCPEWKLLWDGLQWHKECCGVH--GYKDWMNAEWMPRRENNCTSMVL----APFACCKRSCD- 190

  Fly   214 SSGLVNIMCGYGVQVRSVAAASKR---------IWTSGCIE--IVRVWVERNLYVIAGVALGIAL 267
             |...|.:...|   :|:...|::         |..:||:.  :..||   |.:.|. :||.:..
  Fly   191 -SCFNNFLPSEG---QSIGGNSRQPFPALTVDSINANGCLPAFVSAVW---NCFYIL-MALWVLA 247

  Fly   268 LQLFVIYLAKT 278
            |:..::....|
  Fly   248 LKFLIVLCCMT 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp86DNP_001262468.1 Tetraspannin 51..283 CDD:278750 62/267 (23%)
penumbra_like_LEL 132..255 CDD:239411 34/151 (23%)
Tsp33BNP_523552.1 Tetraspannin 20..256 CDD:278750 64/267 (24%)
CD151_like_LEL 112..237 CDD:239408 33/140 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442930
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.