DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp86D and Tsp29Fb

DIOPT Version :9

Sequence 1:NP_001262468.1 Gene:Tsp86D / 41310 FlyBaseID:FBgn0037848 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001137809.1 Gene:Tsp29Fb / 34212 FlyBaseID:FBgn0032075 Length:308 Species:Drosophila melanogaster


Alignment Length:317 Identity:77/317 - (24%)
Similarity:130/317 - (41%) Gaps:75/317 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CVKYMIFLLNFLFWLFGGLLLAIG-----VYAFMDKLMDGNGWLRLDTIYDVIFNISLVMIIA-G 88
            |.|||:.:::|:|.|...||:.:|     ::......:||:            |:....::|| |
  Fly    14 CAKYMLIIVSFMFALTAILLIMVGTTIQTIFGDFSLFIDGH------------FSSPPALLIAIG 66

  Fly    89 VIVFTVSFAGCLGALRENTWLLKLYSMCLLLFFILEMSLAIICFVFPQYMNSFLEYQFTDKIIHS 153
            .|:..|:..|..||::|:..::.||.:||.|.||||:|.||..||....:...| .:..::.:..
  Fly    67 FILIAVAALGAYGAVKESVMVINLYGVCLFLVFILEVSAAIAAFVMQSQVRGML-IRTMNQALAE 130

  Fly   154 YRDDSDLQNFIDFAQQEFNCCGLSNAGYQDWSKNEYFNCS---SPSVERCGVPYSCCINATDISS 215
            |..|..:::.:||.|....|||::..  :||  .:|.:.:   :..|:...||.|||.|.....:
  Fly   131 YEHDPYVESGVDFMQSMLECCGVNEP--EDW--KDYLSANVNFTLGVDDVVVPNSCCGNQPTSLN 191

  Fly   216 GLVNIMCGYGVQVRSVAAASKRIWTSGCIEIVRVWVERNLYVIAGVALGIALLQLF----VIYLA 276
            ....:.|             ...:..||...:...|.::..:||..|..:|.:||.    ...||
  Fly   192 DSTQMTC-------------METYDYGCFRKMNFIVSQSAMLIATGATTVAFVQLLGVLCAFMLA 243

  Fly   277 KTLEGQIDLQKS-RWSXVQ-------------------------------CHHPYLY 301
            |||.....:::: ||. .|                               .|.||.|
  Fly   244 KTLRRNKSIREARRWQLQQSLGVLISGGKMAPPQNSAVTGYQQLDNGEQGSHEPYTY 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp86DNP_001262468.1 Tetraspannin 51..283 CDD:278750 61/244 (25%)
penumbra_like_LEL 132..255 CDD:239411 25/125 (20%)
Tsp29FbNP_001137809.1 Tetraspannin 14..246 CDD:278750 68/261 (26%)
tetraspanin_LEL 110..218 CDD:239401 25/125 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.