DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp86D and TSPAN33

DIOPT Version :9

Sequence 1:NP_001262468.1 Gene:Tsp86D / 41310 FlyBaseID:FBgn0037848 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_848657.1 Gene:TSPAN33 / 340348 HGNCID:28743 Length:283 Species:Homo sapiens


Alignment Length:292 Identity:119/292 - (40%)
Similarity:175/292 - (59%) Gaps:26/292 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 FSYVSSCVKYMIFLLNFLFWLFGGLLLAIGVYAFMDKLMDGN-GWLRLDTIYDVIFNISLVMIIA 87
            ||:||..|||::|..|.|||:...:::|:||||.:.|..:.. ..|.:|.        ::::|:.
Human    15 FSFVSPLVKYLLFFFNMLFWVISMVMVAVGVYARLMKHAEAALACLAVDP--------AILLIVV 71

  Fly    88 GVIVFTVSFAGCLGALRENTWLLKLYSMCLLLFFILEMSLAIICFVFPQYMNSFLEYQFTDKIIH 152
            ||::|.::|.||:|:||||..||:.:|:||...|:|:::..|:.|||.......:.....:.|:|
Human    72 GVLMFLLTFCGCIGSLRENICLLQTFSLCLTAVFLLQLAAGILGFVFSDKARGKVSEIINNAIVH 136

  Fly   153 SYRDDSDLQNFIDFAQQEFNCCGLSNAGYQDWSKNEYFNCS--SPSVERCGVPYSCCINATDISS 215
             ||||.||||.|||.|::|:|||  ...|:|||:|.|||||  :||.|||.||||||:...|  .
Human   137 -YRDDLDLQNLIDFGQKKFSCCG--GISYKDWSQNMYFNCSEDNPSRERCSVPYSCCLPTPD--Q 196

  Fly   216 GLVNIMCGYGVQVRSVAAASKRIWTSGCIEIVRVWVERNLYVIAGVALGIALLQLFVIYLAKTLE 280
            .::|.|||.|:|......|||.|:|:|||:.:..|:..||:::.|||||:|:.||..|.|::.|.
Human   197 AVINTMCGQGMQAFDYLEASKVIYTNGCIDKLVNWIHSNLFLLGGVALGLAIPQLVGILLSQILV 261

  Fly   281 GQIDLQKSRWSXVQCHHPYLYGYPPCEDDPYY 312
            .||..|..... .|.|..          ||:|
Human   262 NQIKDQIKLQLYNQQHRA----------DPWY 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp86DNP_001262468.1 Tetraspannin 51..283 CDD:278750 99/234 (42%)
penumbra_like_LEL 132..255 CDD:239411 58/124 (47%)
TSPAN33NP_848657.1 penumbra_like_LEL 116..236 CDD:239411 58/124 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 208 1.000 Domainoid score I2867
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8213
Inparanoid 1 1.050 220 1.000 Inparanoid score I3567
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48585
OrthoDB 1 1.010 - - D1416189at2759
OrthoFinder 1 1.000 - - FOG0003557
OrthoInspector 1 1.000 - - otm40708
orthoMCL 1 0.900 - - OOG6_108299
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6362
SonicParanoid 1 1.000 - - X349
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.810

Return to query results.
Submit another query.