DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp86D and Tspan17

DIOPT Version :9

Sequence 1:NP_001262468.1 Gene:Tsp86D / 41310 FlyBaseID:FBgn0037848 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_006253692.1 Gene:Tspan17 / 306771 RGDID:1311167 Length:281 Species:Rattus norvegicus


Alignment Length:283 Identity:115/283 - (40%)
Similarity:167/283 - (59%) Gaps:26/283 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VSSCVKYMIFLLNFLFWLFGGLLLAIGVYAFMDK--------LMDGNGWLRLDTIYDVIFNISLV 83
            |..|.||.:|..|.:||:.|.|.||||::|:.:|        |.|..|   ||.::        :
  Rat    13 VGCCGKYFLFGFNIVFWVLGALFLAIGLWAWGEKGVLSNISGLTDLGG---LDPVW--------L 66

  Fly    84 MIIAGVIVFTVSFAGCLGALRENTWLLKLYSMCLLLFFILEMSLAIICFVFPQYMNSFLEYQFTD 148
            .::.|.|:..:.||||:|||||||:|||.:|:.|.|.|.||::..|:.|||..::...|.. |.:
  Rat    67 FVVIGGIMSVLGFAGCIGALRENTFLLKFFSVFLGLIFFLELAAGILAFVFKDWIRDQLNL-FIN 130

  Fly   149 KIIHSYRDDSDLQNFIDFAQQEFNCCGLSNAGYQDWSKNEYFNCS--SPSVERCGVPYSCCINAT 211
            ..:.:||||.||||.|||||:.::|||.  .|..||:.|.||||:  :||.||||||:|||:.  
  Rat   131 NNVKAYRDDIDLQNLIDFAQEYWSCCGA--RGPNDWNLNIYFNCTDLNPSRERCGVPFSCCVR-- 191

  Fly   212 DISSGLVNIMCGYGVQVRSVAAASKRIWTSGCIEIVRVWVERNLYVIAGVALGIALLQLFVIYLA 276
            |.:..::|..|||.::::........|:|.||:.....|::.||.|:|||.:.|||||:..|.||
  Rat   192 DPAEDVLNTQCGYDIRLKLELEQQGSIYTKGCVGQFEKWLQDNLIVVAGVLVAIALLQICGICLA 256

  Fly   277 KTLEGQIDLQKSRWSXVQCHHPY 299
            :.|...|:..|:.||.:....||
  Rat   257 QNLVSDIEAVKANWSLLSQTTPY 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp86DNP_001262468.1 Tetraspannin 51..283 CDD:278750 98/241 (41%)
penumbra_like_LEL 132..255 CDD:239411 50/124 (40%)
Tspan17XP_006253692.1 TM4SF9_like_LEL 115..235 CDD:239412 50/124 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48585
OrthoDB 1 1.010 - - D574036at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X349
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.