DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp86D and tsp-2

DIOPT Version :9

Sequence 1:NP_001262468.1 Gene:Tsp86D / 41310 FlyBaseID:FBgn0037848 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_498803.1 Gene:tsp-2 / 259752 WormBaseID:WBGene00006628 Length:234 Species:Caenorhabditis elegans


Alignment Length:164 Identity:43/164 - (26%)
Similarity:74/164 - (45%) Gaps:30/164 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 DKLMDGNGWLRLDTIYDVIFNISLVMIIAGVIVFTVSFAGCLGALRENTWLLKLYSMCLLLFFIL 123
            |...|...|     ||.|.::|..:.||||    .:|..|.:||:.:...:|....:.:::|||:
 Worm    58 DDKFDMRSW-----IYSVYWSIYGLCIIAG----PLSIIGLIGAISQKKPVLATCLVLIVIFFIM 113

  Fly   124 EMSLAIICFVFPQYMNSFLEYQFTDKI--IHSYRDDSDLQNFIDFAQQEFNCCGLSNAGYQDWSK 186
            |:..:|..:.....:.|.| |:|.:.|  .:|..|.|.:||       .:||||:.:.   .|  
 Worm   114 ELGGSIALWSKRGSLRSLL-YRFANDIYLTNSVFDISIIQN-------TYNCCGVQDG---QW-- 165

  Fly   187 NEYFNCSSPSVERCGVPYSCCINATDISSGLVNI 220
                .|  |:...|.:.....::.|.:.||::.|
 Worm   166 ----KC--PNAPSCDIALFNSVDNTMMISGIILI 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp86DNP_001262468.1 Tetraspannin 51..283 CDD:278750 43/164 (26%)
penumbra_like_LEL 132..255 CDD:239411 22/91 (24%)
tsp-2NP_498803.1 Tetraspannin <84..203 CDD:278750 32/129 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.