DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp86D and Prph2

DIOPT Version :9

Sequence 1:NP_001262468.1 Gene:Tsp86D / 41310 FlyBaseID:FBgn0037848 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_037153.1 Gene:Prph2 / 25534 RGDID:3549 Length:346 Species:Rattus norvegicus


Alignment Length:284 Identity:74/284 - (26%)
Similarity:123/284 - (43%) Gaps:63/284 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IFLLNFLFWLFGGLLLAIGVYAFMDKLMDGNGWLRLDTIYDVIFN-----ISLVMIIAGVI--VF 92
            ::|:|:|..|.|.:|.::|::..::        ||..:  ||:.|     :...:|..||:  ||
  Rat    20 LWLMNWLSVLAGIVLFSLGLFLKIE--------LRKRS--DVMDNSESHFVPNSLIGVGVLSCVF 74

  Fly    93 TVSFAG--CLGAL------RENTWLLKLYSMCLLLFFILEMSLAIICFVFPQYMNSFLEYQFTDK 149
            . |.||  |..||      :...| ||||....:.|.::...:|:.||:....:.|.|.|...:.
  Rat    75 N-SLAGKICYDALDPAKYAKWKPW-LKLYLAVCVFFNVILFLVALCCFLLRGSLESTLAYGLKNG 137

  Fly   150 IIHSYRDDSD-----LQNFIDFAQQEFNCCGLSNAGYQDWSK-----NEYFNCSSPSV-ERC--- 200
            :.: |||...     ::..||..|.||.|||  |.|::||.:     |.|.:.||..| :|.   
  Rat   138 MKY-YRDTDTPGRCFMKKTIDMLQIEFKCCG--NNGFRDWFEIQWISNRYLDFSSKEVKDRIKSN 199

  Fly   201 --------GVPYSCCINATD---ISSGLVNIMCGYGVQVRSVAAASKRIWTSGCIEIVRVWVERN 254
                    |||:|||..::.   |...|.|....|....::   ....:|..||...:     .|
  Rat   200 VDGRYLVDGVPFSCCNPSSPRPCIQYQLTNNSAHYSYDHQT---EELNLWLRGCRAAL-----LN 256

  Fly   255 LYVIAGVALGIALLQLFVIYLAKT 278
            .|.....::|:..|.:::..::.|
  Rat   257 YYSSLMNSMGVVTLLIWLFEVSIT 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp86DNP_001262468.1 Tetraspannin 51..283 CDD:278750 68/268 (25%)
penumbra_like_LEL 132..255 CDD:239411 38/147 (26%)
Prph2NP_037153.1 Tetraspannin 20..277 CDD:278750 73/279 (26%)
TDT 58..>123 CDD:296283 20/66 (30%)
peripherin_like_LEL 120..262 CDD:239415 40/152 (26%)
Interaction with MREG. /evidence=ECO:0000250 341..346
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.