DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp86D and TSPAN15

DIOPT Version :9

Sequence 1:NP_001262468.1 Gene:Tsp86D / 41310 FlyBaseID:FBgn0037848 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_036471.1 Gene:TSPAN15 / 23555 HGNCID:23298 Length:294 Species:Homo sapiens


Alignment Length:267 Identity:91/267 - (34%)
Similarity:147/267 - (55%) Gaps:28/267 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 YPHHFSYVSSCVKYMIFLLNFLFWLFGGLLLAIGVYAFMDKLMDGNGWLRLDTIYDVIFNISLVM 84
            |...|||:  .:|:.:.:.:.:|||.|.|:|::|:||.:::       .:..|:.......::::
Human    11 YCARFSYL--WLKFSLIIYSTVFWLIGALVLSVGIYAEVER-------QKYKTLESAFLAPAIIL 66

  Fly    85 IIAGVIVFTVSFAGCLGALRENTWLLKLYSMCLLLFFILEMSLAIICFVFPQYMNSFLEYQFTDK 149
            |:.||::|.|||.|.|.:||:|.:||:.:...|.:..|:|:...::...|......||    .|.
Human    67 ILLGVVMFMVSFIGVLASLRDNLYLLQAFMYILGICLIMELIGGVVALTFRNQTIDFL----NDN 127

  Fly   150 I---IHSYRDDSDLQNFIDFAQQEFNCCGLSNAGYQDWSKNEYFNCSSPSVERCGVPYSCCI-NA 210
            |   |.:|.||.|.:|.:||.|::|.|||  ...|:|||||:|.:||:|....|||||:||| |.
Human   128 IRRGIENYYDDLDFKNIMDFVQKKFKCCG--GEDYRDWSKNQYHDCSAPGPLACGVPYTCCIRNT 190

  Fly   211 TDISSGLVNIMCGYGVQVRSVAAASKRIWTSGCIEIVRVWVERNLYVIAGVALGIALLQ-----L 270
            |::    ||.||||....:...:....|:..||...|.:|...|..::||:.|||.|.|     |
Human   191 TEV----VNTMCGYKTIDKERFSVQDVIYVRGCTNAVIIWFMDNYTIMAGILLGILLPQFLGVLL 251

  Fly   271 FVIYLAK 277
            .::|:.:
Human   252 TLLYITR 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp86DNP_001262468.1 Tetraspannin 51..283 CDD:278750 80/236 (34%)
penumbra_like_LEL 132..255 CDD:239411 49/126 (39%)
TSPAN15NP_036471.1 penumbra_like_LEL 114..231 CDD:239411 49/126 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1416189at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.