DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp86D and tsp-3

DIOPT Version :9

Sequence 1:NP_001262468.1 Gene:Tsp86D / 41310 FlyBaseID:FBgn0037848 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_499724.1 Gene:tsp-3 / 192059 WormBaseID:WBGene00006629 Length:223 Species:Caenorhabditis elegans


Alignment Length:272 Identity:56/272 - (20%)
Similarity:97/272 - (35%) Gaps:87/272 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SYVSSCVKYMIFLLNFLFWLFGGLLLAIGVYAFMDKLMDGNGWLRLDTIYD-------------- 75
            |:.:...:..:|.||....|.|..::|:.::...||..:..  :|.:.:.|              
 Worm     2 SFCTFLARIFLFFLNLAQTLVGFTVIALTLWIRFDKGFESE--IRTNILRDNDPEPLAGVKSDIR 64

  Fly    76 ----VIFNISLVMIIAGVIVFTVSFAGCLGALRENTWLLKLYSMCLLLFFILEMSLAIICFVFPQ 136
                |.|.|.:...||.||   :.|.|.:||:..:.:||..|.:.:::.|:||:::.|...|..:
 Worm    65 TGIIVSFWIIIGFAIANVI---IGFVGVIGAVIRSKYLLAPYFLFMVILFLLEIAIGITVLVKRR 126

  Fly   137 YM-NSFLEYQFTDKIIHSYRDDSDLQNFIDFAQQEFNCCGLSNAGYQDWSKNEYFNCSSPSVERC 200
            .: .:..||.| |....:.:.|....||      .:||||..|                      
 Worm   127 SVRRTVKEYVF-DSFNMNAQADISAFNF------RYNCCGAEN---------------------- 162

  Fly   201 GVPYSCCINATDISSGLVNIMCGYGVQVRSVAAASKRIWTSGCIEIVRVW--VERNLYVIAGVAL 263
                            |.|:.|..|....|.|                ||  ::..:.:.....|
 Worm   163 ----------------LPNLNCFAGQPTCSSA----------------VWDRLDFTMMIFGICML 195

  Fly   264 GIALLQLFVIYL 275
            .|.:||:|..:|
 Worm   196 IIVVLQMFTAFL 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp86DNP_001262468.1 Tetraspannin 51..283 CDD:278750 50/246 (20%)
penumbra_like_LEL 132..255 CDD:239411 21/125 (17%)
tsp-3NP_499724.1 Tetraspannin 9..208 CDD:278750 55/265 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.