DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp86D and tsp-12

DIOPT Version :9

Sequence 1:NP_001262468.1 Gene:Tsp86D / 41310 FlyBaseID:FBgn0037848 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_501853.1 Gene:tsp-12 / 177890 WormBaseID:WBGene00006638 Length:308 Species:Caenorhabditis elegans


Alignment Length:286 Identity:93/286 - (32%)
Similarity:153/286 - (53%) Gaps:33/286 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SYVSSCVKYMIFLLNFLFWLFGGLLLAIGVYAFMDK-----LMDGNGWLRLDTIYDVIFNISLVM 84
            |.:|.||||.:|..|.:|:|.|..||..||:|.::|     ::.....|.||..:.        :
 Worm    32 SEISCCVKYSVFSFNVIFFLLGFGLLLFGVWAQIEKNTFVNMLSKASKLYLDPTWP--------L 88

  Fly    85 IIAGVIVFTVSFAGCLGALRENTWLLKLYSMCLLLFFILEMSLAIICFVFPQYMNSFLEYQFTDK 149
            :|.|.:.|.:.|:||:|:|||||..|..||..|.|..|.|.|..:..:.....:::::.....|.
 Worm    89 LIVGFLTFIIGFSGCVGSLRENTSFLTFYSTLLGLLLIAEFSAGVFAYACRDQLDNYIRNLLNDV 153

  Fly   150 IIHSYRDDSDLQNFIDFAQQEFNCCGLSNAGYQDWSKNEYFNCSSPSV---ERCGVPYSCCINAT 211
            :: .||||.|||..||..|:.:.|||::  |..||.:|.||:..:..|   |..|||:|||||::
 Worm   154 VV-GYRDDPDLQLLIDSMQETWMCCGIN--GADDWDRNTYFSIEAREVASPEAGGVPFSCCINSS 215

  Fly   212 DISSGLVNIMCGYGVQVR------------SVAAASKRIWTSGCIEIVRVWVERNLYVIAGVALG 264
            .:.  ..|..||:||:::            .|.|.:..|:|.||:..:::|:..|:.::|...:.
 Worm   216 KLE--FKNYFCGHGVRLKPESHMAAHLAAQRVMAHTASIYTEGCLPKLQLWLNNNMLLVAVSMVI 278

  Fly   265 IALLQLFVIYLAKTLEGQIDLQKSRW 290
            ||::|:..|..|:.|:..|..|:::|
 Worm   279 IAIIQVLGICFAQNLKSDILAQRAKW 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp86DNP_001262468.1 Tetraspannin 51..283 CDD:278750 77/251 (31%)
penumbra_like_LEL 132..255 CDD:239411 42/137 (31%)
tsp-12NP_501853.1 Tetraspannin 38..293 CDD:306775 86/267 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166635
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48585
OrthoDB 1 1.010 - - D574036at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X349
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.820

Return to query results.
Submit another query.