DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp86D and tspan10

DIOPT Version :9

Sequence 1:NP_001262468.1 Gene:Tsp86D / 41310 FlyBaseID:FBgn0037848 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_031750424.1 Gene:tspan10 / 101731851 XenbaseID:XB-GENE-990323 Length:358 Species:Xenopus tropicalis


Alignment Length:265 Identity:92/265 - (34%)
Similarity:144/265 - (54%) Gaps:25/265 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VKYMIFLLNFLFWLFGGLLLAIGVYAFMDK---LMDGNGWLRLDTIYDVIFNISLVMIIAGVIVF 92
            :||::|..||:|.:.|..|...||:..:||   :.|..|:|..|.:      :|.||:  |:||.
 Frog    90 IKYLMFFTNFVFSILGFALFGFGVWGLVDKQSLISDRIGYLGTDPM------LSFVMV--GLIVS 146

  Fly    93 TVSFAGCLGALRENTWLLKLYSMCLLLFFILEMSLAIICFVFPQYM-----NSFLEYQFTDKIIH 152
            .:|.:||||.:|||.:||:.:|:.:.:..:.::..|||.|.|...:     ||.|      ..:.
 Frog   147 FLSVSGCLGFIRENIYLLRCFSLGISILMVTQLLSAIIIFAFKDQIIGSVKNSLL------VALS 205

  Fly   153 SYRDDSDLQNFIDFAQQEFNCCGLSNAGYQDWSKNEYFNCSSPSVERCGVPYSCCINATDISSGL 217
            .|.|||||:..:|..|....|||:.:  |.||:.:.|||||||.|..|||||||||:..: :..:
 Frog   206 RYHDDSDLKFIMDEVQLGMECCGVQS--YTDWAVSLYFNCSSPGVYACGVPYSCCIDPFE-NGTV 267

  Fly   218 VNIMCGYGVQVRSVAAASKRIWTSGCIEIVRVWVERNLYVIAGVALGIALLQLFVIYLAKTLEGQ 282
            :|..||.|........|...|:..||:..:.:|::|..:.||.|.|.:.::||..:..|:.:.|:
 Frog   268 INSQCGVGAMQMGETMAGSVIFLGGCVPQMILWLQRKFWDIAAVFLLVMVIQLVCVVCAQRMLGE 332

  Fly   283 IDLQK 287
            |...|
 Frog   333 IKFIK 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp86DNP_001262468.1 Tetraspannin 51..283 CDD:278750 82/239 (34%)
penumbra_like_LEL 132..255 CDD:239411 46/127 (36%)
tspan10XP_031750424.1 Tetraspannin 90..326 CDD:395265 88/252 (35%)
oculospanin_like_LEL 186..303 CDD:239420 45/125 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1416189at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.