DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp86D and LOC101730599

DIOPT Version :9

Sequence 1:NP_001262468.1 Gene:Tsp86D / 41310 FlyBaseID:FBgn0037848 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_017947977.1 Gene:LOC101730599 / 101730599 -ID:- Length:311 Species:Xenopus tropicalis


Alignment Length:270 Identity:88/270 - (32%)
Similarity:141/270 - (52%) Gaps:37/270 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RISTYPHHFSYVSSCVKYMIFLLNFLFWLFGGLLLAIGVYAFMDKLMDGNGWLRLDTIYDVIFNI 80
            :.|..|:::|      |:.:...:.||.|.|.::|.||:||..::       .:..|:..:....
 Frog     8 KASLRPYYYS------KFSLSFYSTLFSLIGLVILCIGIYAESER-------QKHRTLEGIFLAP 59

  Fly    81 SLVMIIAGVIVFTVSFAGCLGALRENTWLLKLYSMCLLLFFILEMSLAIICFVFPQYMNSFLEYQ 145
            ::::::.|:|:|.|||.|.:|:||:|..|:||:...||..|::|:.|.||..||...|..|....
 Frog    60 AVILLLLGIIMFAVSFIGMVGSLRDNILLVKLFFWVLLAIFLIELLLIIIELVFENQMKKFAHAN 124

  Fly   146 FTDKIIHSYRDDSDLQNFIDFAQQEFNCCGLSNAGYQDWSKNEYFNCSSPSVERCGVPYSCCINA 210
            .... :..|.||.|.:|.:||.|::|:|||  ...::||..|:|.:|:|.....|||||:|||..
 Frog   125 ILVG-MQQYYDDLDFKNIMDFVQEKFSCCG--GDDFKDWKVNQYHSCNSTGPLACGVPYTCCITG 186

  Fly   211 TDISSGLVNIMCGY------GVQVRSVAAASKRIWTSGCIEIVRVWVERN--------LYVIAGV 261
            .: |.|:.|.:|||      .::|.|:      |...|||..|.:|:..|        |.::|..
 Frog   187 KE-SGGVKNTLCGYQTLDKERLEVHSI------IHVRGCIHAVGLWLGDNYGVTIGLVLALLAPQ 244

  Fly   262 ALGIALLQLF 271
            .|||.|..||
 Frog   245 GLGIGLSYLF 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp86DNP_001262468.1 Tetraspannin 51..283 CDD:278750 79/235 (34%)
penumbra_like_LEL 132..255 CDD:239411 45/136 (33%)
LOC101730599XP_017947977.1 penumbra_like_LEL 112..230 CDD:239411 44/127 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1416189at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.