DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp86D and LOC100492058

DIOPT Version :9

Sequence 1:NP_001262468.1 Gene:Tsp86D / 41310 FlyBaseID:FBgn0037848 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_002934422.3 Gene:LOC100492058 / 100492058 -ID:- Length:300 Species:Xenopus tropicalis


Alignment Length:262 Identity:101/262 - (38%)
Similarity:159/262 - (60%) Gaps:17/262 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VKYMIFLLNFLFWLFGGLLLAIGVYAFMDKLMDGNGWLRLDTIYDVIFNISLVMIIA-GVIVFTV 94
            |||.:|:..:|||:..||::|:|:||         .:.:..||.|.:.....|::.| |:::|.:
 Frog     7 VKYSLFVSCYLFWVASGLMIAVGIYA---------KFCKETTIVDSLTTDPAVIVTAVGILMFAI 62

  Fly    95 SFAGCLGALRENTWLLKLYSMCLLLFFILEMSLAIICFVFPQYMNSFLEYQFTDKIIHSYRDDSD 159
            :|.||:||||:...|||:::..||:..||:...|::.|:|...:...:....| :.|:.||:|.|
 Frog    63 TFVGCMGALRDLHILLKIFAWMLLIVLILQFVAAVLGFMFSGMVLEKVSSVMT-RAINRYREDLD 126

  Fly   160 LQNFIDFAQQEFNCCGLSNAGYQDWSKNEYFNC--SSPSVERCGVPYSCCINATDISSGLVNIMC 222
            ||||||:.|::|.|||::|  |:|||:|.||.|  |:||:|:|||||||||.  :....::|.||
 Frog   127 LQNFIDYLQKKFECCGVNN--YRDWSQNLYFYCSESNPSLEKCGVPYSCCIK--ENGQKVINTMC 187

  Fly   223 GYGVQVRSVAAASKRIWTSGCIEIVRVWVERNLYVIAGVALGIALLQLFVIYLAKTLEGQIDLQK 287
            ||..|.|........|:..||::.:..|...||.::.|:|:|:..|::||..||..|..||:...
 Frog   188 GYQTQNRMQWDVDDMIYVEGCLDKIVSWGRGNLLLLGGLAMGLIFLEIFVASLAIILIYQINFIM 252

  Fly   288 SR 289
            .|
 Frog   253 ER 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp86DNP_001262468.1 Tetraspannin 51..283 CDD:278750 89/234 (38%)
penumbra_like_LEL 132..255 CDD:239411 52/124 (42%)
LOC100492058XP_002934422.3 Tetraspannin 7..244 CDD:366035 97/250 (39%)
penumbra_like_LEL 100..215 CDD:239411 51/119 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1416189at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.