DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp86D and prph2

DIOPT Version :9

Sequence 1:NP_001262468.1 Gene:Tsp86D / 41310 FlyBaseID:FBgn0037848 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_002934729.1 Gene:prph2 / 100491776 XenbaseID:XB-GENE-985594 Length:349 Species:Xenopus tropicalis


Alignment Length:329 Identity:75/329 - (22%)
Similarity:132/329 - (40%) Gaps:93/329 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IFLLNFLFWLFGGLLLAIGVYAFMD-----KLMDGNGWLRLDTIYDVIFNISLVMIIAGVIVFTV 94
            ::|:|:...|.|..|.::|::..::     ::||.          :....:...:|:.|.:...:
 Frog    20 LWLMNWCCVLAGIALFSMGIFLKIELRKRSEIMDN----------EESHFVPNSLILMGALACAL 74

  Fly    95 -SFAG--CLGALREN---TW--LLKLYSMCLLLFFILEMSLAIICFVFPQYMNSFLEYQFTDKII 151
             :|||  |..:|..|   .|  :||.|....|||.:......::||:....::|.|.:...:.: 
 Frog    75 NAFAGKICYDSLDPNKFAKWKPMLKPYLTVCLLFNVFIFFTGVVCFLARGSLDSTLAHGLKNGM- 138

  Fly   152 HSYRDDSD------LQNFIDFAQQEFNCCGLSNAGYQDWSK-----NEYFNCSSPSV-ERC---- 200
             .|..|:|      ::..||..|.||.|||  |.|::||.:     |.|.:.||..| :|.    
 Frog   139 -RYYKDTDTPGRCFMKKTIDLLQIEFKCCG--NKGFRDWFELQWVSNRYLDFSSKEVKDRIKSNV 200

  Fly   201 -------GVPYSCC----------INATDISSGLVNIMCGYGVQVRSVAAASKRIWTSGCIEIVR 248
                   |||:|||          :..|:.|:..     .|..|...:     .:||.||.|.:.
 Frog   201 DGKYLIDGVPFSCCNPSSPRPCIQLQVTNNSAHY-----SYDHQTEEL-----NLWTRGCKEALL 255

  Fly   249 VWVERNLYVIAGVALGIALLQLFVIYLAKTL-----------------EGQI------DLQKSRW 290
            .:....:..:.|:.:.:.:|::.|:...:.|                 ||.|      |..||.|
 Frog   256 TYYTSMMSSMGGMVMLVWILEMVVMIGLRFLHTCLESIANPEDPECESEGWILEKSLKDTIKSSW 320

  Fly   291 SXVQ 294
            ..|:
 Frog   321 ELVK 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp86DNP_001262468.1 Tetraspannin 51..283 CDD:278750 64/294 (22%)
penumbra_like_LEL 132..255 CDD:239411 39/155 (25%)
prph2XP_002934729.1 peripherin_like_LEL 120..259 CDD:239415 39/152 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.