DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14694 and SLC19A2

DIOPT Version :9

Sequence 1:NP_650028.1 Gene:CG14694 / 41307 FlyBaseID:FBgn0037845 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_008927.1 Gene:SLC19A2 / 10560 HGNCID:10938 Length:497 Species:Homo sapiens


Alignment Length:473 Identity:161/473 - (34%)
Similarity:256/473 - (54%) Gaps:43/473 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ESWLKISCLLCIFGFLRELRPSEPYHAEILMGEWYHVTQDEVNRSVYPVGTYSYLALLIFVFLIT 66
            |.|...:.|||.:||...||||||:....|:|...::|:.||...:|||.|||||.||..|||.|
Human    28 ECWFLPTALLCAYGFFASLRPSEPFLTPYLLGPDKNLTEREVFNEIYPVWTYSYLVLLFPVFLAT 92

  Fly    67 DLLRYKPVIIANATTGICIWGTLIWTTTLSGLQAVEVFYGFYQAGEVAYYSYIYAKVDKQYYPRV 131
            |.||||||::....:.|..|..|::...|..:|.:|.|||...|.|:|||||||:.||...|.:|
Human    93 DYLRYKPVVLLQGLSLIVTWFMLLYAQGLLAIQFLEFFYGIATATEIAYYSYIYSVVDLGMYQKV 157

  Fly   132 TSHTRAAMFVGKLVAGILAQMVIGMRWMNYKQLFYITVTSQVAALLWAFFLPKVEKSLYFH---N 193
            ||:.|:|..||..|..:|.|:::.:...:...|..|::|....|...|:|||..:|||:||   :
Human   158 TSYCRSATLVGFTVGSVLGQILVSVAGWSLFSLNVISLTCVSVAFAVAWFLPMPQKSLFFHHIPS 222

  Fly   194 RSEAIEGGTKSDGG-----------------------NLEKGSEQPSNEEASQEKKIPALQLLWS 235
            ..:.:.|....:||                       |:|   |.|..|...:..::..|::||:
Human   223 TCQRVNGIKVQNGGIVTDTPASNHLPGWEDIESKIPLNME---EPPVEEPEPKPDRLLVLKVLWN 284

  Fly   236 HFRSAYTNPLVIQWSLWYAISLAGFLQITTYMQVVW-KSFENEPTIAWNGAVDVALTLLSAVFAL 299
            .|...|::..::.||:|:|:|..|:.|:..|.|.:| |...:.....:||.|:...|||.||...
Human   285 DFLMCYSSRPLLCWSVWWALSTCGYFQVVNYTQGLWEKVMPSRYAAIYNGGVEAVSTLLGAVAVF 349

  Fly   300 LAGYFHAGRLNTRS-SLLSMALLSVLEGGCVLLSCWTDDIYLSYLGYVLYGGLFAFTITVASSEL 363
            ..||.   :::..: ..::::|.|:|....|.:.....:|::.|..||::..::...||:|:.::
Human   350 AVGYI---KISWSTWGEMTLSLFSLLIAAAVYIMDTVGNIWVCYASYVVFRIIYMLLITIATFQI 411

  Fly   364 ASSLEEDSFALVFGFNTFVGLLLQCILTFVVVSEKANLNLNVFQQFSVYAFYFIVIGIVY--SIA 426
            |::|..:.:|||||.|||:.|.||.:||.:|| :.:.|.|.:..||.:||.||.:|.:|:  |.|
Human   412 AANLSMERYALVFGVNTFIALALQTLLTLIVV-DASGLGLEITTQFLIYASYFALIAVVFLASGA 475

  Fly   427 VILQYIWSISKKPKAIQE 444
            |      |:.||.:.:::
Human   476 V------SVMKKCRKLED 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14694NP_650028.1 Folate_carrier 2..411 CDD:280024 149/436 (34%)
SLC19A2NP_008927.1 Folate_carrier 28..458 CDD:307744 149/436 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147306
Domainoid 1 1.000 274 1.000 Domainoid score I1777
eggNOG 1 0.900 - - E1_KOG3810
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 287 1.000 Inparanoid score I2837
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56145
OrthoDB 1 1.010 - - D344994at33208
OrthoFinder 1 1.000 - - FOG0001487
OrthoInspector 1 1.000 - - mtm8471
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10686
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X476
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.