DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4511 and Txndc9

DIOPT Version :9

Sequence 1:NP_001163585.1 Gene:CG4511 / 41305 FlyBaseID:FBgn0037843 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_742051.1 Gene:Txndc9 / 98258 MGIID:2138153 Length:226 Species:Mus musculus


Alignment Length:215 Identity:115/215 - (53%)
Similarity:153/215 - (71%) Gaps:5/215 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ANILENQLFTAAKTIEQQLDQQLDRLDNLDSDDLKVLREQRLREMKDLNNKKQEWLRNGHGTYTE 66
            :.:||||...|||.:|..||.::.:||.:..|:|::|:|:||..::....:|||||..|||.|.|
Mouse    11 SEVLENQFLQAAKLVENHLDSEIQKLDQIGEDELELLKEKRLAALRKAQQQKQEWLSKGHGEYRE 75

  Fly    67 LADEKEFFEMSKKSPNIVCHFYRDSTERCKIVDMHLKILAAKHVEAKFCKVNAEKTPFLTQRLRI 131
            :..|::||:..|:|..:|||||||:|.||||:|.||.|||.||:|.||.|:|.||.|||.:||||
Mouse    76 IGSERDFFQEVKESEKVVCHFYRDTTFRCKILDRHLAILAKKHLETKFLKLNVEKAPFLCERLRI 140

  Fly   132 KVIPTIALVKDSKTKDFIVGFTDLGNCDDFATEMLEWRIAHSGAIDYKGDLMQPPDVKRKP---- 192
            |||||:||::|.||:|::||||||||.|||.||.||||:..|..|:|.|:||:||...:|.    
Mouse   141 KVIPTLALLRDGKTQDYVVGFTDLGNTDDFTTETLEWRLGCSDVINYSGNLMEPPFQSQKKFGTN 205

  Fly   193 FINRPQKTIRG-GYDSDDSD 211
            |....:||||| .||||..|
Mouse   206 FTKLEKKTIRGKKYDSDSDD 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4511NP_001163585.1 crotonase-like <11..46 CDD:304874 14/34 (41%)
Phd_like_TxnDC9 60..171 CDD:239287 72/110 (65%)
Txndc9NP_742051.1 Phd_like_TxnDC9 68..180 CDD:239287 72/111 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842664
Domainoid 1 1.000 122 1.000 Domainoid score I5643
eggNOG 1 0.900 - - E2759_KOG1672
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4225
Inparanoid 1 1.050 243 1.000 Inparanoid score I3292
Isobase 1 0.950 - 0 Normalized mean entropy S1434
OMA 1 1.010 - - QHG54224
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002555
OrthoInspector 1 1.000 - - oto92004
orthoMCL 1 0.900 - - OOG6_101215
Panther 1 1.100 - - LDO PTHR21148
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1508
SonicParanoid 1 1.000 - - X2265
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.