DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4511 and PLP1

DIOPT Version :9

Sequence 1:NP_001163585.1 Gene:CG4511 / 41305 FlyBaseID:FBgn0037843 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_010469.3 Gene:PLP1 / 851764 SGDID:S000002591 Length:230 Species:Saccharomyces cerevisiae


Alignment Length:226 Identity:67/226 - (29%)
Similarity:113/226 - (50%) Gaps:20/226 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NILENQLFTAAKTI--------EQQLDQQLDRLD-NLDSDD--LKVLREQRLREMKD-LNNKKQE 55
            |:|.|.......|:        |:.||:.|:.|| .||.|.  |...|.:||:::.| |...|:.
Yeast    11 NVLSNAEKDKHTTVDSDDKSSGEENLDELLNELDRELDEDHEFLSAYRSERLQQISDHLKQVKKN 75

  Fly    56 WLRNGHGTYTELADEKEFFEMSKKSPNIVCHFYRDSTERCKIVDMHLKILAAKHVEAKFCKVNAE 120
            ...:|:|....:.:|.:..::..|:..:|.||..::..:|:.::..|:.||.:::..:|.|||.:
Yeast    76 VEDDGYGRLQCIDNEADAIQICTKTTMVVIHFELETFGKCQYMNEKLENLAKRYLTTRFIKVNVQ 140

  Fly   121 KTPFLTQRLRIKVIPTIALVKDSKTKDFIVGFTDLGN-CDDFATEMLEWRIAHSGAIDYKGDLMQ 184
            ..|||..:|.|||:|.:...|:...|...|||:.||| .:.|....||..:||||.|:...::.:
Yeast   141 TCPFLVNKLNIKVLPFVVGYKNGLEKVRYVGFSKLGNDPNGFDIRRLEQSLAHSGVIEDTFEIRK 205

  Fly   185 PPDVKRKPFINRPQKTIRGGYDSDDSDIDLD 215
            ...|..:.|.:.       .:|..:||.|||
Yeast   206 HSSVNTERFAST-------NHDRSESDSDLD 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4511NP_001163585.1 crotonase-like <11..46 CDD:304874 14/45 (31%)
Phd_like_TxnDC9 60..171 CDD:239287 34/111 (31%)
PLP1NP_010469.3 Phd_like_TxnDC9 80..192 CDD:239287 34/111 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I2535
eggNOG 1 0.900 - - E2759_KOG1672
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I1519
Isobase 1 0.950 - 0 Normalized mean entropy S1434
OMA 1 1.010 - - QHG54224
OrthoFinder 1 1.000 - - FOG0002555
OrthoInspector 1 1.000 - - oto98986
orthoMCL 1 0.900 - - OOG6_101215
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1508
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.710

Return to query results.
Submit another query.