DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4511 and TRX3

DIOPT Version :9

Sequence 1:NP_001163585.1 Gene:CG4511 / 41305 FlyBaseID:FBgn0037843 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_010006.1 Gene:TRX3 / 850444 SGDID:S000000679 Length:127 Species:Saccharomyces cerevisiae


Alignment Length:116 Identity:26/116 - (22%)
Similarity:55/116 - (47%) Gaps:6/116 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KVLREQRLREMKDLNNKKQEWLRNGHGTYTELADEKEFFEMSKKSPNIVCHFYRDSTERCKIVDM 100
            |.:....:|.:|.:.      .::.:.:.|:|.:..||..:.|::..:|..||......||::..
Yeast     5 KPVMRMAVRPLKSIR------FQSSYTSITKLTNLTEFRNLIKQNDKLVIDFYATWCGPCKMMQP 63

  Fly   101 HLKILAAKHVEAKFCKVNAEKTPFLTQRLRIKVIPTIALVKDSKTKDFIVG 151
            ||..|...:.:.:|.|.:.:::|.:.:...:..:||..|.||.:....|:|
Yeast    64 HLTKLIQAYPDVRFVKCDVDESPDIAKECEVTAMPTFVLGKDGQLIGKIIG 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4511NP_001163585.1 crotonase-like <11..46 CDD:304874 2/9 (22%)
Phd_like_TxnDC9 60..171 CDD:239287 23/92 (25%)
TRX3NP_010006.1 TRX_family 35..125 CDD:239245 21/80 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1434
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.