DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4511 and TTL4

DIOPT Version :9

Sequence 1:NP_001163585.1 Gene:CG4511 / 41305 FlyBaseID:FBgn0037843 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_191421.2 Gene:TTL4 / 825031 AraportID:AT3G58620 Length:682 Species:Arabidopsis thaliana


Alignment Length:153 Identity:38/153 - (24%)
Similarity:62/153 - (40%) Gaps:26/153 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DLKVLRE------------QRLREMKDLNNKKQEWLRNGHGTYTELADEKEFFEMSKKSPNI-VC 85
            |.:|||:            ||.|..  |:||.:|....|.....|.....:.|:.:...|.| |.
plant   539 DYEVL
RKELPGDSEVAESLQRARNA--LSNKSEEPKYLGFNNEVEEVSTLDKFKTATSLPGISVF 601

  Fly    86 HFYRDSTERCKIVDMHLKILAAKHVEAKFCKVNAEKTPFLTQRLRIKVIPTIALV-KDSKTKDFI 149
            ||...|..:.:.:...:..|..::....|.||:.|::..|.:...||.|||..:. |..|.|:.:
plant   602 HFKSSSNRQSEAISPFVNTLCLRYPLVHFFKVDVEESLALAKAESIKKIPTFKIYKKGEKVKEMV 666

  Fly   150 VGFTDLGNCDDFATEMLEWRIAH 172
                    |.  :.::||..:.|
plant   667 --------CP--SHQLLEDSVTH 679

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4511NP_001163585.1 crotonase-like <11..46 CDD:304874 7/23 (30%)
Phd_like_TxnDC9 60..171 CDD:239287 26/112 (23%)
TTL4NP_191421.2 3a0801s09 <214..>325 CDD:273380
TPR repeat 215..239 CDD:276809
TPR repeat 244..274 CDD:276809
TPR repeat 279..302 CDD:276809
TPR repeat 402..430 CDD:276809
3a0801s09 <447..>543 CDD:273380 1/3 (33%)
TPR repeat 482..512 CDD:276809
TPR repeat 517..541 CDD:276809 1/1 (100%)
TRX_family 589..674 CDD:239245 22/94 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.