DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4511 and PLP3a

DIOPT Version :9

Sequence 1:NP_001163585.1 Gene:CG4511 / 41305 FlyBaseID:FBgn0037843 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001325881.1 Gene:PLP3a / 824260 AraportID:AT3G50960 Length:230 Species:Arabidopsis thaliana


Alignment Length:209 Identity:73/209 - (34%)
Similarity:109/209 - (52%) Gaps:9/209 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ILENQLFTAAKTIEQQLDQQLDRLDNLDSDDLKVLREQRLREMKDLNNKKQEWLRNGHGTYTELA 68
            :|.|:....:..:.:::|  ||.|  :|..:|:.|...|:..:|....|::.:.|.|||.|.|::
plant    30 VLANEKAQGSNPVNEEVD--LDEL--MDDPELERLHADRIAALKREVEKRESFKRQGHGEYREVS 90

  Fly    69 DEKEFFEMSKKSPNIVCHFYRDSTERCKIVDMHLKILAAKHVEAKFCKVNAEKTPFLTQRLRIKV 133
             |.:|.....:|..::||||.....||||:|.|||.||.:||:.||.||:||..||...:|.||.
plant    91 -EGDFLGEVTRSEKVICHFYHKEFYRCKIMDKHLKTLAPRHVDTKFIKVDAENAPFFVTKLAIKT 154

  Fly   134 IPTIALVKDSKTKDFIVGFTDLGNCDDFATEMLEWRIAHSGAIDYKGDLMQPPDVKRKPFINRPQ 198
            :|.:.|.......|.:|||.|||..|||.|..||..:...|.:..|.......|.:.:..|.|  
plant   155 LPCVVLFSKGVAMDRLVGFQDLGTKDDFTTNKLENVLLKKGMLSKKKKEEDDEDAEYQESIRR-- 217

  Fly   199 KTIRGGYDSD-DSD 211
             ::|...:.| |||
plant   218 -SVRSSENLDSDSD 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4511NP_001163585.1 crotonase-like <11..46 CDD:304874 8/34 (24%)
Phd_like_TxnDC9 60..171 CDD:239287 50/110 (45%)
PLP3aNP_001325881.1 Phd_like_TxnDC9 81..190 CDD:239287 50/109 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1672
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54224
OrthoDB 1 1.010 - - D1444223at2759
OrthoFinder 1 1.000 - - FOG0002555
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101215
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2265
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.690

Return to query results.
Submit another query.