DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4511 and AT3G25580

DIOPT Version :9

Sequence 1:NP_001163585.1 Gene:CG4511 / 41305 FlyBaseID:FBgn0037843 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_566772.1 Gene:AT3G25580 / 822145 AraportID:AT3G25580 Length:210 Species:Arabidopsis thaliana


Alignment Length:216 Identity:98/216 - (45%)
Similarity:149/216 - (68%) Gaps:11/216 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAN----ILENQLFTAAKTIEQQLDQQLDRLDNLDSDDLKVLREQRLREMKDLNNKKQEWLRNGH 61
            |||    |:|.|:.|.||.:|.::|.::..|:.||.|||:||||:||::||.:..||:.|:..||
plant     1 MANPIQEIIEKQVLTVAKAMEDKIDDEIASLEKLDEDDLEVLRERRLKQMKKMAEKKKRWMSIGH 65

  Fly    62 GTYTELADEKEFFEMSKKSPNIVCHFYRDSTERCKIVDMHLKILAAKHVEAKFCKVNAEKTPFLT 126
            |.|:|:..||:||.:.|.|..:||||||::.. ||::|.|:.|||.:|:|.:|.|:.|||:|||.
plant    66 GEYSEIHSEKDFFSVVKSSERVVCHFYRENWP-CKVMDKHMSILAKQHIETRFVKIQAEKSPFLA 129

  Fly   127 QRLRIKVIPTIALVKDSKTKDFIVGFTDLGNCDDFATEMLEWRIAHSGAIDYKGDLMQPPDVKRK 191
            :||:|.|:||:||:|::|..|::|||.:||..|||:||.||.|||.:..|.|:|:    ..:|:|
plant   130 ERLKIVVLPTLALIKNTKVDDYVVGFNELGGKDDFSTEDLEERIARAQVIHYEGE----SSLKQK 190

  Fly   192 PFINRPQKTIRGGYDSD-DSD 211
            . ..:.::.:|....|| ||:
plant   191 S-TTQVRRNVRQSARSDSDSE 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4511NP_001163585.1 crotonase-like <11..46 CDD:304874 17/34 (50%)
Phd_like_TxnDC9 60..171 CDD:239287 58/110 (53%)
AT3G25580NP_566772.1 Phd_like_TxnDC9 64..174 CDD:239287 58/110 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 103 1.000 Domainoid score I2260
eggNOG 1 0.900 - - E2759_KOG1672
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4225
Inparanoid 1 1.050 197 1.000 Inparanoid score I1333
OMA 1 1.010 - - QHG54224
OrthoDB 1 1.010 - - D1444223at2759
OrthoFinder 1 1.000 - - FOG0002555
OrthoInspector 1 1.000 - - otm3260
orthoMCL 1 0.900 - - OOG6_101215
Panther 1 1.100 - - O PTHR21148
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2265
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.