DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4511 and qtrt2

DIOPT Version :9

Sequence 1:NP_001163585.1 Gene:CG4511 / 41305 FlyBaseID:FBgn0037843 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001016891.1 Gene:qtrt2 / 549645 XenbaseID:XB-GENE-1007716 Length:413 Species:Xenopus tropicalis


Alignment Length:215 Identity:48/215 - (22%)
Similarity:77/215 - (35%) Gaps:70/215 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 HGTYTELADEKEFFEMSKKS-------PNIV--CHFYRDSTERC-------KIVDM-----HLKI 104
            |.|.:.||:.:|..|..|:.       |:.|  |..: |....|       |.|.:     .:::
 Frog    61 HITLSTLAEHQEVLEEYKEGIGKFAGMPDAVLYCSTH-DPVSPCPTGYNTNKAVSLWGAGGRIEM 124

  Fly   105 LAAKHVEAK--------FCKVNAEKTPFLTQRLRIK--VIPTIALVKDSKTKDFIVGFTDLGNCD 159
            .|.|.:.|:        .|..:.|.||....|.|:|  |..|:|.:  .:....:.|..||..|.
 Frog   125 TAQKFISAQRVLRPDWFQCLSDGEVTPGGNSRKRVKKSVDRTLAFL--DECLQLLSGHEDLKPCV 187

  Fly   160 DFAT----EMLEWRIA------------------HSGAIDYKGDLMQ------PPDVKRKPFIN- 195
            ....    ::||.|:.                  |.|:.:.:..|:.      |.|..|  ||: 
 Frog   188 LIGAVEGGDLLEERLRSARETAKRPVGGFLLDGFHGGSAEKELSLISAVTAALPEDKPR--FIHG 250

  Fly   196 --RPQKT---IRGGYDSDDS 210
              ||.:.   ::.|.|..||
 Frog   251 MGRPDEVLECVQRGVDLFDS 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4511NP_001163585.1 crotonase-like <11..46 CDD:304874
Phd_like_TxnDC9 60..171 CDD:239287 34/144 (24%)
qtrt2NP_001016891.1 TGT 11..411 CDD:396321 48/215 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 298..321
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1508
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.