DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4511 and qtrt2

DIOPT Version :9

Sequence 1:NP_001163585.1 Gene:CG4511 / 41305 FlyBaseID:FBgn0037843 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001112368.2 Gene:qtrt2 / 402798 ZFINID:ZDB-GENE-060427-4 Length:416 Species:Danio rerio


Alignment Length:217 Identity:48/217 - (22%)
Similarity:70/217 - (32%) Gaps:84/217 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 LADEKEFFEMSKKSPNIVCHF--YRDSTERCKIVDMHLKILAAKHV-----------------EA 112
            ||:.:|..|..|:.   |..|  .||:...|.:.| ......|.||                 .|
Zfish    67 LAEHQEVLEEFKEG---VRKFAGLRDTVIFCSLHD-SASPSPAGHVTNKTVSVWGSGGRIELTAA 127

  Fly   113 KFCKVNAEKTPFLTQ---------------RLRIKVIPTIA-----LVKDSKTKDF----IVGFT 153
            :|..:.|...|...|               |:|..|..|:|     ||...||::.    |.|..
Zfish   128 RFMSIQAAVQPDCYQSMADGETWQANTSRKRVRKAVDRTLAHLDECLVLHQKTQELKHAEIFGVV 192

  Fly   154 DLGNCDDFATEMLEWRIA------------------HSGAI--DYKGDLMQPPDV---KRKP--- 192
            :.|       ::||.|:.                  ||.|:  |.:..|:|....   :.||   
Zfish   193 EGG-------DILEERLRSARETAKRPVGGFVLDGFHSSAMDQDVRAQLIQETSAELPQEKPRLV 250

  Fly   193 -FINRPQKTI---RGGYDSDDS 210
             .:.||.:.|   ..|.|..:|
Zfish   251 LGVGRPDEVISCVEAGVDLFES 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4511NP_001163585.1 crotonase-like <11..46 CDD:304874
Phd_like_TxnDC9 60..171 CDD:239287 34/146 (23%)
qtrt2NP_001112368.2 TGT 137..407 CDD:279966 31/143 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1508
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.