DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4511 and CG7650

DIOPT Version :9

Sequence 1:NP_001163585.1 Gene:CG4511 / 41305 FlyBaseID:FBgn0037843 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_648786.1 Gene:CG7650 / 39694 FlyBaseID:FBgn0036519 Length:276 Species:Drosophila melanogaster


Alignment Length:172 Identity:45/172 - (26%)
Similarity:78/172 - (45%) Gaps:11/172 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TAAKTIEQQLDQQLD-RLDNLDSDD-LKVLREQRLREMKDLNNKKQEWLRNGHGTYTELADEKEF 73
            |:|:..|::..::|| .||.|.|:| |:..::||:.||.......|::     |...:|...:||
  Fly   106 TSAEDEERKRQEELDAELDELMSEDFLQQYQKQRMAEMLRQTGHHQQF-----GQVQQLTSHEEF 165

  Fly    74 F---EMSKKSPNIVCHFYRDSTERCKIVDMHLKILAAKHVEAKFCKVNAEKTPFLTQRLRIKVIP 135
            .   |...|...|:.|.|......|..::..|..||:.:...||.|: ......:::..|.|.:|
  Fly   166 LACVEQENKHTTIIIHIYERQLAACATLNKCLDSLASDYPSIKFAKI-CSSVAGMSRDFRTKGLP 229

  Fly   136 TIALVKDSKTKDFIVGFTDLGNCDDFATEMLEWRIAHSGAID 177
            .:.:.|........|..||..:.|.||:::..:.|.|...:|
  Fly   230 ALLVYKAQAVIGNFVRLTDDLSDDFFASDVESFLIEHGIIVD 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4511NP_001163585.1 crotonase-like <11..46 CDD:304874 13/36 (36%)
Phd_like_TxnDC9 60..171 CDD:239287 26/113 (23%)
CG7650NP_648786.1 Phd_like_Phd 60..267 CDD:239285 43/166 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468334
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.