DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4511 and viaf

DIOPT Version :9

Sequence 1:NP_001163585.1 Gene:CG4511 / 41305 FlyBaseID:FBgn0037843 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_524032.2 Gene:viaf / 39364 FlyBaseID:FBgn0036237 Length:240 Species:Drosophila melanogaster


Alignment Length:203 Identity:55/203 - (27%)
Similarity:89/203 - (43%) Gaps:36/203 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DQQLDRLDNL-DSDDLKVL---REQRLREMKDLNNKKQEWLRNGHGTYTELADEKEFFEMSKKSP 81
            |..||.||.| ||:|..||   |::|:.||:....|.:      .|:..|::.:....|::|...
  Fly    61 DMSLDELDELEDSEDEAVLEQYRQRRIAEMRATAEKAR------FGSVREISGQDYVNEVTKAGE 119

  Fly    82 NI--VCHFYRDSTERCKIVDMHLKILAAKHVEAKFCK-VNAEKTPFLTQRLRIKVIPTIALVKDS 143
            .|  |.|.|.:....|.::..|::.||.:..:.||.: |.....|...:    |.:|||.:..:.
  Fly   120 GIWVVLHLYANGVPLCALIHHHMQQLAVRFPQTKFVRSVATTCIPNFPE----KNLPTIFIYHEG 180

  Fly   144 KTKDFIVGFTDLGNCDDFATEMLEWRIAHSGAIDYKGDLMQPPDVKRKPFINRPQKTIRGGYDSD 208
            ..:...:|..:|.. |....|.||:.:..:||:        |.::...|   |||  ||     |
  Fly   181 ALRKQYIGPLELRG-DKLTAEELEFMLGQAGAV--------PTEITEDP---RPQ--IR-----D 226

  Fly   209 DSDIDLDD 216
            ....||:|
  Fly   227 KMLADLED 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4511NP_001163585.1 crotonase-like <11..46 CDD:304874 13/28 (46%)
Phd_like_TxnDC9 60..171 CDD:239287 26/113 (23%)
viafNP_524032.2 Phd_like_VIAF 8..210 CDD:239286 42/159 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468333
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.