DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4511 and CG3434

DIOPT Version :9

Sequence 1:NP_001163585.1 Gene:CG4511 / 41305 FlyBaseID:FBgn0037843 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_648320.1 Gene:CG3434 / 39098 FlyBaseID:FBgn0036000 Length:418 Species:Drosophila melanogaster


Alignment Length:97 Identity:23/97 - (23%)
Similarity:34/97 - (35%) Gaps:18/97 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 KTPFLTQRLRIKVIPTIA---LVKDSKTKDFIVGFTDLGNCDDFATEMLEWRIAHS-GAIDYKG- 180
            |||.|.|..:...||.::   .......|..::.|| |...:.....:..|..... |..||.| 
  Fly    28 KTPLLLQTTKGGSIPWLSADVFETHVSRKPQVLQFT-LSTMEQMTEALTHWNSGGGRGLSDYVGL 91

  Fly   181 ----DLMQPPDVKRKPFINRPQKTIRGGYDSD 208
                :::    :.|.|....|.    ||.|.|
  Fly    92 PGHLNIL----LLRDPCETTPS----GGNDRD 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4511NP_001163585.1 crotonase-like <11..46 CDD:304874
Phd_like_TxnDC9 60..171 CDD:239287 12/52 (23%)
CG3434NP_648320.1 TGT 139..382 CDD:279966
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1508
SonicParanoid 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.