DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4511 and txndc9

DIOPT Version :9

Sequence 1:NP_001163585.1 Gene:CG4511 / 41305 FlyBaseID:FBgn0037843 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001315504.1 Gene:txndc9 / 336625 ZFINID:ZDB-GENE-030131-8569 Length:226 Species:Danio rerio


Alignment Length:218 Identity:123/218 - (56%)
Similarity:163/218 - (74%) Gaps:5/218 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MANILENQLFTAAKTIEQQLDQQLDRLDNLDSDDLKVLREQRLREMKDLNNKKQEWLRNGHGTYT 65
            :|..||.|:..:|:.:|:|||.:|::|:.:|.|:|::|:|:||..:|....:||||:..|||.|.
Zfish     9 VAKALEQQVLQSARMVEEQLDAELEKLERMDEDELELLKERRLEALKKAQKQKQEWISKGHGEYR 73

  Fly    66 ELADEKEFFEMSKKSPNIVCHFYRDSTERCKIVDMHLKILAAKHVEAKFCKVNAEKTPFLTQRLR 130
            |:..||:||...|:|.::|||||||||.||||:|.||.|||.||:|.||.|:|.||.||||:|||
Zfish    74 EIPSEKDFFPEVKESKSVVCHFYRDSTFRCKILDKHLAILAKKHLETKFIKLNVEKAPFLTERLR 138

  Fly   131 IKVIPTIALVKDSKTKDFIVGFTDLGNCDDFATEMLEWRIAHSGAIDYKGDLMQPPDVKRK---P 192
            ||||||:|||||.||||:||||:||||.|:|.|||||||:..|..|:|.|:|::||.|.:|   .
Zfish   139 IKVIPTLALVKDGKTKDYIVGFSDLGNTDEFPTEMLEWRLGCSDIINYSGNLLEPPTVGQKTGSK 203

  Fly   193 FINRPQKTIRG-GYDSD-DSDID 213
            |....:||||| .|||| :||.|
Zfish   204 FTKVEKKTIRGKAYDSDSESDED 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4511NP_001163585.1 crotonase-like <11..46 CDD:304874 14/34 (41%)
Phd_like_TxnDC9 60..171 CDD:239287 78/110 (71%)
txndc9NP_001315504.1 RapA_C <1..58 CDD:288951 19/48 (40%)
Phd_like_TxnDC9 67..179 CDD:239287 78/111 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587087
Domainoid 1 1.000 128 1.000 Domainoid score I5275
eggNOG 1 0.900 - - E2759_KOG1672
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4225
Inparanoid 1 1.050 252 1.000 Inparanoid score I3198
OMA 1 1.010 - - QHG54224
OrthoDB 1 1.010 - - D1444223at2759
OrthoFinder 1 1.000 - - FOG0002555
OrthoInspector 1 1.000 - - oto38685
orthoMCL 1 0.900 - - OOG6_101215
Panther 1 1.100 - - LDO PTHR21148
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1508
SonicParanoid 1 1.000 - - X2265
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1716.800

Return to query results.
Submit another query.