DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4511 and txdc-9

DIOPT Version :9

Sequence 1:NP_001163585.1 Gene:CG4511 / 41305 FlyBaseID:FBgn0037843 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_498410.1 Gene:txdc-9 / 182257 WormBaseID:WBGene00006515 Length:208 Species:Caenorhabditis elegans


Alignment Length:215 Identity:99/215 - (46%)
Similarity:137/215 - (63%) Gaps:13/215 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ANILE---NQLFTAAKTIEQQLDQQLDRLDNLDSDDLKVLREQRLREMKDLNNKKQEWLRNGHGT 63
            |||.:   .||..||:.:|:|:||::::|:||:.|||:|:|.||:.:||.....:.|.|.:|||.
 Worm     3 ANIQQQFGEQLLRAAQVVEEQIDQEMNKLENLEEDDLEVIRRQRMEQMKKAQKDRIEMLSHGHGK 67

  Fly    64 YTELADEKEFFEMSKKSPNIVCHFYRDSTERCKIVDMHLKILAAKHVEAKFCKVNAEKTPFLTQR 128
            |.|:||||||||.:|||..:||.||.....||||||.|.:|||.|||..:|..|||||..|||.|
 Worm    68 YEEVADEKEFFEATKKSDKVVCLFYLPGNFRCKIVDKHFEILARKHVGTRFIHVNAEKVHFLTTR 132

  Fly   129 LRIKVIPTIALVKDSKTKDFIVGFTDLGNCDDFATEMLEWRIAHSGAIDYKGDLMQPPDVKRKPF 193
            |.|:|||:||:|...:|.|:|.||.:||..|:|.||.:|.|:|.|..:          .|::|..
 Worm   133 LNIRVIPSIAIVVKQQTVDYIRGFDELGGKDEFTTETMENRLARSEVL----------TVEKKHT 187

  Fly   194 INRPQKTIRGGYDSDDSDID 213
            ....:|.||.|.:..|::.|
 Worm   188 APAKKKIIRSGVEEYDNEED 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4511NP_001163585.1 crotonase-like <11..46 CDD:304874 16/34 (47%)
Phd_like_TxnDC9 60..171 CDD:239287 64/110 (58%)
txdc-9NP_498410.1 Phd_like_TxnDC9 63..175 CDD:239287 64/111 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162548
Domainoid 1 1.000 102 1.000 Domainoid score I4310
eggNOG 1 0.900 - - E2759_KOG1672
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4225
Inparanoid 1 1.050 185 1.000 Inparanoid score I2614
Isobase 1 0.950 - 0 Normalized mean entropy S1434
OMA 1 1.010 - - QHG54224
OrthoDB 1 1.010 - - D1444223at2759
OrthoFinder 1 1.000 - - FOG0002555
OrthoInspector 1 1.000 - - oto17631
orthoMCL 1 0.900 - - OOG6_101215
Panther 1 1.100 - - LDO PTHR21148
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1508
SonicParanoid 1 1.000 - - X2265
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1716.750

Return to query results.
Submit another query.