DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6567 and AT1G52470

DIOPT Version :9

Sequence 1:NP_001097742.1 Gene:CG6567 / 41304 FlyBaseID:FBgn0037842 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_175656.2 Gene:AT1G52470 / 841678 AraportID:AT1G52470 Length:235 Species:Arabidopsis thaliana


Alignment Length:230 Identity:52/230 - (22%)
Similarity:90/230 - (39%) Gaps:35/230 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VNATGKHTASVIFFHGSGDTGPNVLEWVRFLIGRNLEYPHIKIIYPTAPKQKYTPLDGELSNVWF 72
            |...|...||:::.|...:...:.:::|:.|..:|:.:....|:|               :|..:
plant    21 VEPQGDQRASIVWLHDKDEHFTDSVQFVKSLKLKNVNWICPPIVY---------------TNTSY 70

  Fly    73 DRKSVNIAASESKKSMSQCYDAVNQLIDEEVASGIPLNRIV-VGGFSMGGALALHTG-------Y 129
            |..| || ..:.::::......|..|:..|     |||.:. ||||.||..:||...       |
plant    71 DFGS-NI-KQDDREALDSAAKFVADLLLRE-----PLNVVKGVGGFGMGAVVALQFATNCALGHY 128

  Fly   130 HLR-RSLAGVFAHSSFLN--RGSVVYDSLANGKDESFPELRMYHGERDTLVPKDWGLETFENLTK 191
            .:. |.:.|:....|...  ..|:.|...|..:..| .::....|..:.|:|.....|..|:|.:
plant   129 PINPRVVVGINGWLSITGSITSSIEYTVGAVARAAS-QKIFFTRGAENRLLPYTREEEVVESLRE 192

  Fly   192 LGVKGTFHPLRNTLHELKTASITD-LQQWIYEKLP 225
            .|....|..:.:.|.......|.| |:.|:...||
plant   193 AGFGDVFFLIYSWLRHEHHLDIRDMLKLWLELSLP 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6567NP_001097742.1 Abhydrolase 7..221 CDD:304388 50/224 (22%)
AT1G52470NP_175656.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0400
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373549at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.