DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6567 and AT1G52460

DIOPT Version :9

Sequence 1:NP_001097742.1 Gene:CG6567 / 41304 FlyBaseID:FBgn0037842 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_175655.2 Gene:AT1G52460 / 841677 AraportID:AT1G52460 Length:230 Species:Arabidopsis thaliana


Alignment Length:245 Identity:58/245 - (23%)
Similarity:99/245 - (40%) Gaps:66/245 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VNATGKHTASVIFFHGSGDTGPNVLEWVRFLIGRNLEYPHIKIIYPTA-PKQKYTPLDGELSNVW 71
            |...|:|..::::.|...:...:.:::|:.|...|:::....::.||: .|.:|           
plant    14 VQPKGEHRVTIVWLHDKDEHFSDSVQFVKILNLNNIKWICPSLVLPTSRNKPEY----------- 67

  Fly    72 FDRKSVNIAASESKKSMSQCYDAVNQLIDEEVA---SGIPLNRIV-VGGFSMGGALALH------ 126
                ::|.|.               .|..|.||   |..|.|.|. ||||.||.|:|||      
plant    68 ----NINHAL---------------YLTAERVANLFSDEPENVIKGVGGFGMGAAVALHFATSCA 113

  Fly   127 -TGYHLR-RSLAGVFAHSSFLNRGSVVYDSLANGKDESFP-----ELRMYHGERDTLVPK--DWG 182
             ..|.:. |.:.|:   |.:|::...:..|:.....|:.|     .:.:.||:||. ||.  ..|
plant   114 LNHYTINPRVVVGI---SGWLSKAKSLKRSIEFASYEAPPRAASQSILLTHGQRDH-VPHLCGCG 174

  Fly   183 LETFENLTKLGVK-------GTFHPLRNTLHELKTASITDLQQWIYEKLP 225
            .|....|.:.|.:       ..|.|:   .||:....:  ::.|:.||||
plant   175 EEAAFILREAGFRDVRFLPFARFGPI---AHEINRNVM--VKSWLEEKLP 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6567NP_001097742.1 Abhydrolase 7..221 CDD:304388 54/239 (23%)
AT1G52460NP_175655.2 Abhydrolase 12..>167 CDD:304388 43/186 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0400
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373549at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.