DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6567 and AT1G52440

DIOPT Version :9

Sequence 1:NP_001097742.1 Gene:CG6567 / 41304 FlyBaseID:FBgn0037842 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_175653.2 Gene:AT1G52440 / 841675 AraportID:AT1G52440 Length:200 Species:Arabidopsis thaliana


Alignment Length:235 Identity:46/235 - (19%)
Similarity:81/235 - (34%) Gaps:77/235 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VNATGKHTASVIFFHGSGDTGPNVLEWVRFLIGRNLEYPHIKIIYPTAPKQKYTPLDGELSNVWF 72
            |...|:|...:::.|...:...:.|::|..|..:|:::....:::|                   
plant    18 VQPKGEHRVIIVWLHDKDERSSDSLQFVEQLNLKNVKWICPSLVFP------------------- 63

  Fly    73 DRKSVNIAASESKKSMSQCYDAVNQLIDEEVASGIPLNRIVVGGFSMGGALALH--TGYHLRR-- 133
                                        :....|       |||..||.|:|||  |...|..  
plant    64 ----------------------------DSFIKG-------VGGLGMGAAVALHFATSCALNHYT 93

  Fly   134 -------SLAGVFAHSSFLNRG--SVVYDSLANGKDESFPELRMYHGERDTLV-PKDWGLETFEN 188
                   .::|..::|..|.|.  |..:.:.|....:|   :.:.||..|::. |.|.|.|...:
plant    94 INPRVVVGISGWLSNSGSLKRSIESASHGAPARAASQS---IFITHGICDSVPHPCDCGEEAVLS 155

  Fly   189 LTKLGVKGT-FHPLRN---TLHELKTASITDLQQWIYEKL 224
            |.:.|.:.. |.|...   |.||.....:  ::.|:.|||
plant   156 LREAGFRDVKFTPFARFGPTAHENNRNVM--VKSWLEEKL 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6567NP_001097742.1 Abhydrolase 7..221 CDD:304388 43/230 (19%)
AT1G52440NP_175653.2 Abhydrolase 16..>142 CDD:304388 31/180 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0400
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373549at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.