DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6567 and AT1G51300

DIOPT Version :9

Sequence 1:NP_001097742.1 Gene:CG6567 / 41304 FlyBaseID:FBgn0037842 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001322736.1 Gene:AT1G51300 / 841553 AraportID:AT1G51300 Length:280 Species:Arabidopsis thaliana


Alignment Length:248 Identity:61/248 - (24%)
Similarity:102/248 - (41%) Gaps:58/248 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TVNATGKHTASVIFFHGSGDTGPNVLEWVRFLIGRNLEYPHIKIIYPTAPKQKYTPLDGELSNVW 71
            ||....:|.|::::.|...::|.:..|.|     ::....::|.|.|::|........|..:..|
plant    40 TVTPRARHQATIVWLHDLNESGYDSSELV-----KSFSLYNVKWICPSSPLISNVGFGGAPARAW 99

  Fly    72 FDRKSVNIAAS--------ESKKSMSQCYDAVNQLIDEEVASGIPLNRIVVGGFSMGGALALH-- 126
            |   .||..:|        |..|:.:.....:.:...|.|..|       |.|:.:|||||||  
plant   100 F---KVNEFSSRMPDPYEMEGLKNSAAHVAGLLKNEPENVMKG-------VAGYGIGGALALHIA 154

  Fly   127 TGYHLR------RSLAGVFAHSSFLNRGSVVYDSLANGKDESFPE---------LRMYHGERDTL 176
            |.|.|.      |::.|:   :.:|.....:.|.:     ||.|:         :.:.||..|.:
plant   155 TCYALGSFPIQIRAVVGI---NCWLPNRFKLGDQI-----ESIPDATSRAGELSVLVTHGNNDKM 211

  Fly   177 VPKDWGLETFENLTKLGVK----GTFHPLRNTLHELKTASITD-LQQWIYEKL 224
            ||.:.|..:.|.|:|.|.|    .|.|     |::..|...:. |.|.:|.:|
plant   212 VPYETGRSSAEKLSKAGFKQIKLKTIH-----LYKPSTTFFSSLLSQLLYFRL 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6567NP_001097742.1 Abhydrolase 7..221 CDD:304388 59/243 (24%)
AT1G51300NP_001322736.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0400
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373549at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3034
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.