DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6567 and AT1G47780

DIOPT Version :9

Sequence 1:NP_001097742.1 Gene:CG6567 / 41304 FlyBaseID:FBgn0037842 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001319169.1 Gene:AT1G47780 / 841190 AraportID:AT1G47780 Length:129 Species:Arabidopsis thaliana


Alignment Length:97 Identity:29/97 - (29%)
Similarity:47/97 - (48%) Gaps:14/97 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 WVRFLIG---RNLEYPHIKIIYPTAPKQKYTPLDGELSNVWFDRKSVNIAASESKKSMSQCYDAV 95
            ||..:.|   :|     :|.|.||||::..|.|.|..:|.|||...::....:...|::....::
plant    12 WVLKMYGWMNKN-----VKWICPTAPRRPLTILGGMETNAWFDIAELSENMQDDVASLNHAALSI 71

  Fly    96 NQLIDEEVASGIPLNRIV-VGGFSMGGALALH 126
            ..|:.||     |.|.:: :||...|.|.||:
plant    72 ANLLSEE-----PTNVMIGIGGIGFGAAQALY 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6567NP_001097742.1 Abhydrolase 7..221 CDD:304388 29/97 (30%)
AT1G47780NP_001319169.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0400
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373549at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.