DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6567 and Lypla2

DIOPT Version :9

Sequence 1:NP_001097742.1 Gene:CG6567 / 41304 FlyBaseID:FBgn0037842 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_112632.1 Gene:Lypla2 / 83510 RGDID:620210 Length:231 Species:Rattus norvegicus


Alignment Length:237 Identity:80/237 - (33%)
Similarity:121/237 - (51%) Gaps:26/237 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PALT---TVNATGKHTASVIFFHGSGDTGPNVLEWVRFLIGRNLEYPHIKIIYPTAPKQKYTPLD 64
            |.||   ||:...:.||:|||.||.||||.:   |...|  ..:..||:|.|.|.||:   .|:.
  Rat     9 PLLTDAATVSGAERETAAVIFLHGLGDTGHS---WADAL--STIRLPHVKYICPHAPR---IPVT 65

  Fly    65 GELSNV---WFDRKSVNIAASESKKSMSQCYDAVNQLIDEEVASGIPLNRIVVGGFSMGGALALH 126
            ..:..|   |||...::..|.|.:..:.:..:.:..||:.|:.:|||.||||:||||.||||:|:
  Rat    66 LNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLY 130

  Fly   127 TGYHLRRSLAGVFAHSSF--LNRGSVVYDSLANGKDESFPELRMYHGERDTLVPKDWGLETFENL 189
            |.......|||:.|.|.:  |:|.   :...|||..:....|:. |||.|.:||..:|..|.|.|
  Rat   131 TALTCPHPLAGIVALSCWLPLHRN---FPQAANGSAKDLAILQC-HGELDPMVPVRFGALTAEKL 191

  Fly   190 ----TKLGVKGTFHPLRNTLHELKTASITDLQQWIYEKLPPL 227
                |...|:...:|  ..:|......:..:::::.:.|||:
  Rat   192 RTVVTPARVQFKTYP--GVMHSSCPQEMAAVKEFLEKLLPPV 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6567NP_001097742.1 Abhydrolase 7..221 CDD:304388 74/222 (33%)
Lypla2NP_112632.1 Abhydrolase_2 11..228 CDD:396693 76/230 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0400
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373549at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.